KEGG   Homo sapiens (human): 85320Help
Entry
85320             CDS       T01001                                 

Gene name
ABCC11, EWWD, MRP8, WW
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 11
Orthology
K05671  
ATP-binding cassette, subfamily C (CFTR/MRP), member 11
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q12.1
AA seq 1382 aa AA seqDB search
MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPP
WGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPL
SVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLG
PILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSS
FAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIG
YTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIKLIKMYTWEKP
FAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSM
LASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEAT
LSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKGMML
GVCGNTGSGKSSLLSAILEEMHLLEGSVGVQGSLAYVPQQAWIVSGNIRENILMGGAYDK
ARYLQVLHCCSLNRDLELLPFGDMTEIGERGLNLSGGQKQRISLARAVYSDRQIYLLDDP
LSAVDAHVGKHIFEECIKKTLRGKTVVLVTHQLQYLEFCGQIILLENGKICENGTHSELM
QKKGKYAQLIQKMHKEATSDMLQDTAKIAEKPKVESQALATSLEESLNGNAVPEHQLTQE
EEMEEGSLSWRVYHHYIQAAGGYMVSCIIFFFVVLIVFLTIFSFWWLSYWLEQGSGTNSS
RESNGTMADLGNIADNPQLSFYQLVYGLNALLLICVGVCSSGIFTKVTRKASTALHNKLF
NKVFRCPMSFFDTIPIGRLLNCFAGDLEQLDQLLPIFSEQFLVLSLMVIAVLLIVSVLSP
YILLMGAIIMVICFIYYMMFKKAIGVFKRLENYSRSPLFSHILNSLQGLSSIHVYGKTED
FISQFKRLTDAQNNYLLLFLSSTRWMALRLEIMTNLVTLAVALFVAFGISSTPYSFKVMA
VNIVLQLASSFQATARIGLETEAQFTAVERILQYMKMCVSEAPLHMEGTSCPQGWPQHGE
IIFQDYHMKYRDNTPTVLHGINLTIRGHEVVGIVGRTGSGKSSLGMALFRLVEPMAGRIL
IDGVDICSIGLEDLRSKLSVIPQDPVLLSGTIRFNLDPFDRHTDQQIWDALERTFLTKAI
SKFPKKLHTDVVENGGNFSVGERQLLCIARAVLRNSKIILIDEATASIDMETDTLIQRTI
REAFQGCTVLVIAHRVTTVLNCDHILVMGNGKVVEFDRPEVLRKKPGSLFAALMATATSS
LR
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgactaggaagaggacatactgggtgcccaactcttctggtggcctcgtgaatcgtggc
atcgacataggcgatgacatggtttcaggacttatttataaaacctatactctccaagat
ggcccctggagtcagcaagagagaaatcctgaggctccagggagggcagctgtcccaccg
tgggggaagtatgatgctgccttgagaaccatgattcccttccgtcccaagccgaggttt
cctgccccccagcccctggacaatgctggcctgttctcctacctcaccgtgtcatggctc
accccgctcatgatccaaagcttacggagtcgcttagatgagaacaccatccctccactg
tcagtccatgatgcctcagacaaaaatgtccaaaggcttcaccgcctttgggaagaagaa
gtctcaaggcgagggattgaaaaagcttcagtgcttctggtgatgctgaggttccagaga
acaaggttgattttcgatgcacttctgggcatctgcttctgcattgccagtgtactcggg
ccaatattgattataccaaagatcctggaatattcagaagagcagttggggaatgttgtc
catggagtgggactctgctttgccctttttctctccgaatgtgtgaagtctctgagtttc
tcctccagttggatcatcaaccaacgcacagccatcaggttccgagcagctgtttcctcc
tttgcctttgagaagctcatccaatttaagtctgtaatacacatcacctcaggagaggcc
atcagcttcttcaccggtgatgtaaactacctgtttgaaggggtgtgctatggaccccta
gtactgatcacctgcgcatcgctggtcatctgcagcatttcttcctacttcattattgga
tacactgcatttattgccatcttatgctatctcctggttttcccactggcggtattcatg
acaagaatggctgtgaaggctcagcatcacacatctgaggtcagcgaccagcgcatccgt
gtgaccagtgaagttctcacttgcattaagctgattaaaatgtacacatgggagaaacca
tttgcaaaaatcattgaagacctaagaaggaaggaaaggaaactattggagaagtgcggg
cttgtccagagcctgacaagtataaccttgttcatcatccccacagtggccacagcggtc
tgggttctcatccacacatccttaaagctgaaactcacagcgtcaatggccttcagcatg
ctggcctccttgaatctccttcggctgtcagtgttctttgtgcctattgcagtcaaaggt
ctcacgaattccaagtctgcagtgatgaggttcaagaagtttttcctccaggagagccct
gttttctatgtccagacattacaagaccccagcaaagctctggtctttgaggaggccacc
ttgtcatggcaacagacctgtcccgggatcgtcaatggggcactggagctggagaggaac
gggcatgcttctgaggggatgaccaggcctagagatgccctcgggccagaggaagaaggg
aacagcctgggcccagagttgcacaagatcaacctggtggtgtccaaggggatgatgtta
ggggtctgcggcaacacggggagtggtaagagcagcctgttgtcagccatcctggaggag
atgcacttgctcgagggctcggtgggggtgcagggaagcctggcctatgtcccccagcag
gcctggatcgtcagcgggaacatcagggagaacatcctcatgggaggcgcatatgacaag
gcccgatacctccaggtgctccactgctgctccctgaatcgggacctggaacttctgccc
tttggagacatgacagagattggagagcggggcctcaacctctctggggggcagaaacag
aggatcagcctggcccgcgccgtctattccgaccgtcagatctacctgctggacgacccc
ctgtctgctgtggacgcccacgtggggaagcacatttttgaggagtgcattaagaagaca
ctcagggggaagacggtcgtcctggtgacccaccagctgcagtacttagaattttgtggc
cagatcattttgttggaaaatgggaaaatctgtgaaaatggaactcacagtgagttaatg
cagaaaaaggggaaatatgcccaacttatccagaagatgcacaaggaagccacttcggac
atgttgcaggacacagcaaagatagcagagaagccaaaggtagaaagtcaggctctggcc
acctccctggaagagtctctcaacggaaatgctgtgccggagcatcagctcacacaggag
gaggagatggaagaaggctccttgagttggagggtctaccaccactacatccaggcagct
ggaggttacatggtctcttgcataattttcttcttcgtggtgctgatcgtcttcttaacg
atcttcagcttctggtggctgagctactggttggagcagggctcggggaccaatagcagc
cgagagagcaatggaaccatggcagacctgggcaacattgcagacaatcctcaactgtcc
ttctaccagctggtgtacgggctcaacgccctgctcctcatctgtgtgggggtctgctcc
tcagggattttcaccaaggtcacgaggaaggcatccacggccctgcacaacaagctcttc
aacaaggttttccgctgccccatgagtttctttgacaccatcccaataggccggcttttg
aactgcttcgcaggggacttggaacagctggaccagctcttgcccatcttttcagagcag
ttcctggtcctgtccttaatggtgatcgccgtcctgttgattgtcagtgtgctgtctcca
tatatcctgttaatgggagccataatcatggttatttgcttcatttattatatgatgttc
aagaaggccatcggtgtgttcaagagactggagaactatagccggtctcctttattctcc
cacatcctcaattctctgcaaggcctgagctccatccatgtctatggaaaaactgaagac
ttcatcagccagtttaagaggctgactgatgcgcagaataactacctgctgttgtttcta
tcttccacacgatggatggcattgaggctggagatcatgaccaaccttgtgaccttggct
gttgccctgttcgtggcttttggcatttcctccaccccctactcctttaaagtcatggct
gtcaacatcgtgctgcagctggcgtccagcttccaggccactgcccggattggcttggag
acagaggcacagttcacggctgtagagaggatactgcagtacatgaagatgtgtgtctcg
gaagctcctttacacatggaaggcacaagttgtccccaggggtggccacagcatggggaa
atcatatttcaggattatcacatgaaatacagagacaacacacccaccgtgcttcacggc
atcaacctgaccatccgcggccacgaagtggtgggcatcgtgggaaggacgggctctggg
aagtcctccttgggcatggctctcttccgcctggtggagcccatggcaggccggattctc
attgacggcgtggacatttgcagcatcggcctggaggacttgcggtccaagctctcagtg
atccctcaagatccagtgctgctctcaggaaccatcagattcaacctagatccctttgac
cgtcacactgaccagcagatctgggatgccttggagaggacattcctgaccaaggccatc
tcaaagttccccaaaaagctgcatacagatgtggtggaaaacggtggaaacttctctgtg
ggggagaggcagctgctctgcattgccagggctgtgcttcgcaactccaagatcatcctt
atcgatgaagccacagcctccattgacatggagacagacaccctgatccagcgcacaatc
cgtgaagccttccagggctgcaccgtgctcgtcattgcccaccgtgtcaccactgtgctg
aactgtgaccacatcctggttatgggcaatgggaaggtggtagaatttgatcggccggag
gtactgcggaagaagcctgggtcattgttcgcagccctcatggccacagccacttcttca
ctgagataa

DBGET integrated database retrieval system