KEGG   Homo sapiens (human): 8546Help
Entry
8546              CDS       T01001                                 

Gene name
AP3B1, ADTB3, ADTB3A, HPS, HPS2, PE
Definition
(RefSeq) adaptor related protein complex 3 beta 1 subunit
  KO
K12397  
AP-3 complex subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00166  
Hermansky-Pudlak syndrome (HPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    8546 (AP3B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q14.1
AA seq 1094 aa AA seqDB search
MSSNSFPYNEQSGGGEATELGQEATSTISPSGAFGLFSSDLKKNEDLKQMLESNKDSAKL
DAMKRIVGMIAKGKNASELFPAVVKNVASKNIEIKKLVYVYLVRYAEEQQDLALLSISTF
QRALKDPNQLIRASALRVLSSIRVPIIVPIMMLAIKEASADLSPYVRKNAAHAIQKLYSL
DPEQKEMLIEVIEKLLKDKSTLVAGSVVMAFEEVCPDRIDLIHKNYRKLCNLLVDVEEWG
QVVIIHMLTRYARTQFVSPWKEGDELEDNGKNFYESDDDQKEKTDKKKKPYTMDPDHRLL
IRNTKPLLQSRNAAVVMAVAQLYWHISPKSEAGIISKSLVRLLRSNREVQYIVLQNIATM
SIQRKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVKSQDKQF
AAATIQTIGRCATNILEVTDTCLNGLVCLLSNRDEIVVAESVVVIKKLLQMQPAQHGEII
KHMAKLLDSITVPVARASILWLIGENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLG
AKLYLTNSKQTKLLTQYILNLGKYDQNYDIRDRTRFIRQLIVPNVKSGALSKYAKKIFLA
QKPAPLLESPFKDRDHFQLGTLSHTLNIKATGYLELSNWPEVAPDPSVRNVEVIELAKEW
TPAGKAKQENSAKKFYSESEEEEDSSDSSSDSESESGSESGEQGESGEEGDSNEDSSEDS
SSEQDSESGRESGLENKRTAKRNSKAKGKSDSEDGEKENEKSKTSDSSNDESSSIEDSSS
DSESESEPESESESRRVTKEKEKKTKQDRTPLTKDVSLLDLDDFNPVSTPVALPTPALSP
SLMADLEGLHLSTSSSVISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMV
SIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGSITVSMGIDFCDSTQTA
SFQLCTKDDCFNVNIQPPVGELLLPVAMSEKDFKKEQGVLTGMNETSAVIIAAPQNFTPS
VIFQKVVNVANVGAVPSGQDNIHRFAAKTVHSGSLMLVTVELKEGSTAQLIINTEKTVIG
SVLLRELKPVLSQG
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaatagttttccttacaatgagcagtccggaggaggggaggcgacggagctg
ggtcaggaggcgacctcaaccatttccccctcgggggccttcggcctctttagcagcgat
ttgaagaagaatgaagatctaaagcaaatgttagagagcaacaaagattctgctaaactg
gatgctatgaagcggattgttgggatgattgcaaaagggaaaaatgcatctgaactgttt
cctgctgttgtgaagaatgtggccagtaaaaatattgagatcaagaagttggtatatgtt
tacctggttcgatatgctgaagaacagcaggatcttgcactcctgtccataagcactttt
cagcgagctctgaaggacccaaaccaactaattcgtgcaagcgctttgagagttctgtca
agtattagagtgccaattattgtacctatcatgatgcttgctattaaggaagcttctgct
gacttatcaccatatgttaggaagaatgcagcccatgcaatacaaaaattatacagcctt
gatccagagcagaaggaaatgttaattgaagtaattgaaaaacttctgaaagataaaagc
acattggtagctggcagtgttgtgatggcttttgaagaagtatgcccggacagaatagat
ctgattcataaaaattaccgcaagctatgtaacttactagtggatgttgaagagtggggg
caggttgtcataatccacatgctaactcgatatgctcggacacagtttgtcagcccttgg
aaagagggtgatgaattagaagacaatggaaagaatttctacgaatctgatgatgatcag
aaggaaaagactgacaaaaagaagaagccgtatactatggatccagatcatagactctta
attagaaatacaaagcctttgcttcagagcaggaatgctgcggtggttatggcagttgct
cagctgtattggcacatatcaccaaaatctgaagctggcataatttctaaatcactagtg
cgtttacttcgtagcaatagggaggtgcagtatattgtcctacaaaatatagcaactatg
tcaattcaaagaaaggggatgtttgaaccttatctgaagagtttctatgttaggtcaact
gatccaactatgatcaagacactgaagcttgaaattttgacaaacttggcaaatgaagcc
aacatatcaactcttcttcgagaatttcagacctatgtgaaaagccaggataaacaattt
gcagcagccactattcagactataggcagatgtgcaaccaacatcttggaagtcactgac
acgtgcctcaatggcttggtctgtctgctgtccaacagggatgaaatagttgttgctgaa
agtgtggttgttataaagaaattactgcaaatgcaacctgcacaacatggtgaaattatt
aaacatatggccaaactcctggacagtatcactgttcctgttgctagagcaagtattctt
tggctaattggagaaaactgtgaacgagttcctaaaattgcccctgatgttttgaggaag
atggctaaaagcttcactagtgaagatgatctggtaaaactgcagatattaaatctggga
gcaaaattgtatttaaccaactccaaacagacaaaattgcttacccagtacatattaaat
ctcggcaagtatgatcaaaactacgacatcagagaccgtacaagatttattaggcagctt
attgttccgaatgtaaagagtggagctttaagtaaatatgccaaaaaaatattcctagca
caaaagcctgcaccactgcttgagtctccttttaaagatagagatcatttccagcttggc
accttatctcatactctcaacattaaagctactgggtacctggaattatctaattggcca
gaggtggcgcccgacccatcagttcgaaatgtagaagtaatagagttggcaaaagaatgg
accccagcaggaaaagcaaagcaagagaattctgctaagaagttttattctgaatctgag
gaagaggaggactcttctgatagtagcagtgacagtgagagtgaatctggaagtgaaagt
ggagaacaaggcgaaagtggggaggaaggagacagcaatgaggacagcagtgaggactcc
tccagtgagcaggacagtgagagtggacgggagtcaggcctagaaaacaaaagaacagcc
aagaggaactcaaaagccaaaggaaaaagtgattctgaagatggggagaaggaaaatgaa
aaatctaaaacttcagattcttcaaatgacgaatctagttcaatagaagacagttcttcc
gattctgaatcagagtcagaacctgaaagtgaatctgaatccagaagagtcactaaggag
aaagaaaagaaaacaaagcaagatagaactcctcttaccaaagatgtttcacttctagat
ctggatgattttaacccagtatccactccagttgcacttcccacaccagctctttctcca
agtttgatggctgatcttgaaggtttacacttgtcaacttcctcttcagtcatcagtgtc
agtactcctgcatttgtaccaacgaaaactcacgtgctgcttcatcgaatgagtggaaaa
ggactagctgcccattatttctttccaagacagccttgcatttttggtgataagatggtc
tctatacaaataacactgaataacactactgatcgaaagatagaaaatatccacataggg
gaaaaaaaacttcctataggcatgaaaatgcatgtttttaatccaatagactctcttgag
cctgagggatccattacagtttcaatgggtattgacttttgtgattctactcagactgcc
agtttccagttgtgtaccaaggatgattgcttcaatgttaatattcagccacctgttgga
gaactgcttttacctgtggccatgtcagagaaagattttaagaaagagcaaggagtgcta
acaggaatgaatgaaacttctgctgtaatcattgctgcaccacagaatttcactccctct
gtgatctttcagaaggttgtaaatgtagccaatgtaggtgcagtcccttctggccaggat
aatatacacaggtttgcagctaaaactgtgcacagtgggtcattgatgctagtcacagtg
gaactgaaggaaggctctacagcccagcttatcataaacactgagaaaactgtgattggc
tctgttctgctgcgggaactgaagcctgtcctgtctcaggggtaa

DBGET integrated database retrieval system