KEGG   Homo sapiens (human): 8703Help
Entry
8703              CDS       T01001                                 

Gene name
B4GALT3, beta4Gal-T3
Definition
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 3 (EC:2.4.1.90 2.4.1.38)
Orthology
K07968  
beta-1,4-galactosyltransferase 3 [EC:2.4.1.90 2.4.1.38 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8703 (B4GALT3)
   00514 Other types of O-glycan biosynthesis
    8703 (B4GALT3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    8703 (B4GALT3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    8703 (B4GALT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     8703 (B4GALT3)
    2.4.1.90  N-acetyllactosamine synthase
     8703 (B4GALT3)
    2.4.1.-  
     8703 (B4GALT3)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   8703 (B4GALT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q21-q23
AA seq 393 aa AA seqDB search
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSH
LPGAPGGPPAPQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE
PRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVR
EALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSAL
TPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEEN
PHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPG
SSQAFRQEMLQRRPPARPGPLSTANHTALRGSH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttgcggaggctgctggagcggccttgcacgctggccctgcttgtgggctcccagctg
gctgtcatgatgtacctgtcactggggggcttccgaagtctcagtgccctatttggccga
gatcagggaccgacatttgactattctcaccctcgtgatgtctacagtaacctcagtcac
ctgcctggggccccagggggtcctccagctcctcaaggtctgccctactgtccagaacga
tctcctctcttagtgggtcctgtgtcggtgtcctttagcccagtgccatcactggcagag
attgtggagcggaatccccgggtagaaccagggggccggtaccgccctgcaggttgtgag
ccccgctcccgaacagccatcattgtgcctcatcgtgcccgggagcaccacctgcgcctg
ctgctctaccacctgcaccccttcttgcagcgccagcagcttgcttatggcatctatgtc
atccaccaggctggaaatggaacatttaacagggcaaaactgttgaacgttggggtgcga
gaggccctgcgtgatgaagagtgggactgcctgttcttgcacgatgtggacctcttgcca
gaaaatgaccacaatctgtatgtgtgtgacccccggggaccccgccatgttgccgttgct
atgaacaagtttggatacagcctcccgtacccccagtacttcggaggagtctcagcactt
actcctgaccagtacctgaagatgaatggcttccccaatgaatactggggctggggtggt
gaggatgacgacattgctaccagggtgcgcctggctgggatgaagatctctcggcccccc
acatctgtaggacactataagatggtgaagcaccgaggagataagggcaatgaggaaaat
ccccacagatttgacctcctggtccgtacccagaattcctggacgcaagatgggatgaac
tcactgacataccagttgctggctcgagagctggggcctctttataccaacatcacagca
gacattgggactgaccctcggggtcctcgggctccttctgggccacgttacccacctggt
tcctcccaagccttccgtcaagagatgctgcaacgccggcccccagccaggcctgggcct
ctatctactgccaaccacacagccctccgaggttcacactga

  All links  
No link information was found.   
DBGET integrated database retrieval system