KEGG   Homo sapiens (human): 8704Help
Entry
8704              CDS       T01001                                 

Gene name
B4GALT2, B4Gal-T2, B4Gal-T3, beta4Gal-T2
Definition
(RefSeq) beta-1,4-galactosyltransferase 2
  KO
K07967  beta-1,4-galactosyltransferase 2 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00052  Galactose metabolism
hsa00510  N-Glycan biosynthesis
hsa00514  Other types of O-glycan biosynthesis
hsa00515  Mannose type O-glycan biosynthesis
hsa00533  Glycosaminoglycan biosynthesis - keratan sulfate
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100  Metabolic pathways
Module
hsa_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
hsa_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8704 (B4GALT2)
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8704 (B4GALT2)
   00515 Mannose type O-glycan biosyntheis
    8704 (B4GALT2)
   00514 Other types of O-glycan biosynthesis
    8704 (B4GALT2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    8704 (B4GALT2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    8704 (B4GALT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     8704 (B4GALT2)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     8704 (B4GALT2)
    2.4.1.90  N-acetyllactosamine synthase
     8704 (B4GALT2)
    2.4.1.-  
     8704 (B4GALT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   8704 (B4GALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 8704
NCBI-ProteinID: NP_001005417
OMIM: 604013
HGNC: 925
Ensembl: ENSG00000117411
Vega: OTTHUMG00000008296
Pharos: O60909(Tbio)
UniProt: O60909
Position
1p34.1
AA seq 372 aa AA seqDB search
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASS
SSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLER
VQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYV
INQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIA
MDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
IRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
DIGRPPSWPPRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcagactgctgggggggacgctggagcgcgtctgcaaggctgtgctccttctctgc
ctgctgcacttcctcgtggccgtcatcctctactttgacgtctacgcccagcacctggcc
ttcttcagccgcttcagtgcccgaggccctgcccatgccctccacccagctgctagcagc
agcagcagcagcagcaactgctcccggcccaacgccaccgcctctagctccgggctccct
gaggtccccagtgccctgcccggtcccacggctcccacgctgccaccctgtcctgactcg
ccacctggtcttgtgggcagactgctgatcgagttcacctcacccatgcccctggagcgg
gtgcagagggagaacccaggcgtgctcatgggcggccgatacacaccgcccgactgcacc
ccagcccagacggtggcggtcatcatcccctttagacaccgggaacaccacctgcgctac
tggctccactatctacaccccatcttgaggcggcagcggctgcgctacggcgtctatgtc
atcaaccagcatggtgaggacaccttcaaccgggccaagctgcttaacgtgggcttccta
gaggcgctgaaggaggatgccgcctatgactgcttcatcttcagcgatgtggacctggtc
cccatggatgaccgcaacctataccgctgcggcgaccaaccccgccactttgccattgcc
atggacaagtttggcttccggcttccctatgctggctactttggaggtgtgtcaggcctg
agtaaggctcagtttctgagaatcaatggcttccccaatgagtactggggctggggtggc
gaggatgatgacatcttcaaccggatctccctgactgggatgaagatctcacgcccagac
atccgaatcggccgctaccgcatgatcaagcacgaccgcgacaagcataacgaacctaac
cctcagaggtttaccaagattcaaaacacgaagctgaccatgaagcgggacggcattggg
tcagtgcggtaccaggtcttggaggtgtctcggcaaccactcttcaccaatatcacagtg
gacattgggcggcctccgtcgtggccccctcggggctga

DBGET integrated database retrieval system