KEGG   Homo sapiens (human): 8704Help
Entry
8704              CDS       T01001                                 

Gene name
B4GALT2, B4Gal-T2, B4Gal-T3, beta4Gal-T2
Definition
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2 (EC:2.4.1.22 2.4.1.90 2.4.1.38)
Orthology
K07967  
beta-1,4-galactosyltransferase 2 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8704 (B4GALT2)
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8704 (B4GALT2)
   00514 Other types of O-glycan biosynthesis
    8704 (B4GALT2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    8704 (B4GALT2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    8704 (B4GALT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     8704 (B4GALT2)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     8704 (B4GALT2)
    2.4.1.90  N-acetyllactosamine synthase
     8704 (B4GALT2)
    2.4.1.-  
     8704 (B4GALT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   8704 (B4GALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34-p33
AA seq 372 aa AA seqDB search
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASS
SSSSSNCSRPNATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLER
VQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYV
INQHGEDTFNRAKLLNVGFLEALKEDAAYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIA
MDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD
IRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV
DIGRPPSWPPRG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcagactgctgggggggacgctggagcgcgtctgcaaggctgtgctccttctctgc
ctgctgcacttcctcgtggccgtcatcctctactttgacgtctacgcccagcacctggcc
ttcttcagccgcttcagtgcccgaggccctgcccatgccctccacccagctgctagcagc
agcagcagcagcagcaactgctcccggcccaacgccaccgcctctagctccgggctccct
gaggtccccagtgccctgcccggtcccacggctcccacgctgccaccctgtcctgactcg
ccacctggtcttgtgggcagactgctgatcgagttcacctcacccatgcccctggagcgg
gtgcagagggagaacccaggcgtgctcatgggcggccgatacacaccgcccgactgcacc
ccagcccagacggtggcggtcatcatcccctttagacaccgggaacaccacctgcgctac
tggctccactatctacaccccatcttgaggcggcagcggctgcgctacggcgtctatgtc
atcaaccagcatggtgaggacaccttcaaccgggccaagctgcttaacgtgggcttccta
gaggcgctgaaggaggatgccgcctatgactgcttcatcttcagcgatgtggacctggtc
cccatggatgaccgcaacctataccgctgcggcgaccaaccccgccactttgccattgcc
atggacaagtttggcttccggcttccctatgctggctactttggaggtgtgtcaggcctg
agtaaggctcagtttctgagaatcaatggcttccccaatgagtactggggctggggtggc
gaggatgatgacatcttcaaccggatctccctgactgggatgaagatctcacgcccagac
atccgaatcggccgctaccgcatgatcaagcacgaccgcgacaagcataacgaacctaac
cctcagaggtttaccaagattcaaaacacgaagctgaccatgaagcgggacggcattggg
tcagtgcggtaccaggtcttggaggtgtctcggcaaccactcttcaccaatatcacagtg
gacattgggcggcctccgtcgtggccccctcggggctga

DBGET integrated database retrieval system