KEGG   Homo sapiens (human): 8820Help
Entry
8820              CDS       T01001                                 

Gene name
HESX1, ANF, CPHD5, RPX
Definition
HESX homeobox 1
Orthology
K09354  
homeobox protein expressed in ES cells 1
Organism
hsa  Homo sapiens (human)
Pathway
Signaling pathways regulating pluripotency of stem cells
Disease
H00254  
Pituitary Dwarfism (PD)
H00544  
Septo-optic dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    8820 (HESX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, XANF
    8820 (HESX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p14.3
AA seq 185 aa AA seqDB search
MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCL
HVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQI
EVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFN
TNLLE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccagccttcaggaaggcgctcagctcggggaaaacaaaccctcaacttgctcc
ttttcaattgagagaatcttaggactggaccagaagaaagactgtgttccattaatgaaa
ccccacaggccctgggcagacacctgcagctcatcagggaaagatggtaacttatgtcta
catgtcccaaatcctcccagtgggatttcattccctagcgtggtggatcacccaatgcca
gaagaaagagcttcgaaatatgaaaattacttttcagcctcagaaagactgtctttgaaa
agagagttgagttggtatagaggccgaagaccaagaactgcttttactcaaaaccagatt
gaagtgttagaaaatgtctttagagtaaactgctatcctggtatcgatattagagaagac
ttagctcaaaaattgaatctagaggaagacagaatccagatttggtttcaaaatcggcgt
gcaaaactgaaaaggtcccatagagaatcacagtttctaatggcgaaaaaaaatttcaac
acaaatctgctggaatag

DBGET integrated database retrieval system