KEGG   Homo sapiens (human): 8838Help
Entry
8838              CDS       T01001                                 

Gene name
WISP3, CCN6, LIBC, PPAC, PPD
Definition
WNT1 inducible signaling pathway protein 3
Organism
hsa  Homo sapiens (human)
Disease
H00758  
Progressive pseudorheumatoid dysplasia (PPRD)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q21
AA seq 354 aa AA seqDB search
MQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPR
CPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDYSVDRPRYETGVCAYLVAV
GCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAGSHCSGAKGGKKSDQSNCS
LEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRTCGMGISNRVTNENSNCEM
RKEKRLCYIQPCDSNILKTIKIPKGKTCQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICL
DKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCREPGDIFSELKIL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggctcctcttctccactcttctgcttgctggcctggcacagttctgctgcagg
gtacagggcactggaccattagatacaacacctgaaggaaggcctggagaagtgtcagat
gcacctcagcgtaaacagttttgtcactggccctgcaaatgccctcagcagaagccccgt
tgccctcctggagtgagcctggtgagagatggctgtggatgctgtaaaatctgtgccaag
caaccaggggaaatctgcaatgaagctgacctctgtgacccacacaaagggctgtattgt
gactactcagtagacaggcctaggtacgagactggagtgtgtgcataccttgtagctgtt
gggtgcgagttcaaccaggtacattatcataatggccaagtgtttcagcccaaccccttg
ttcagctgcctctgtgtgagtggggccattggatgcacacctctgttcataccaaagctg
gctggcagtcactgctctggagctaaaggtggaaagaagtctgatcagtcaaactgtagc
ctggaaccattactacagcagctttcaacaagctacaaaacaatgccagcttatagaaat
ctcccacttatttggaaaaaaaaatgtcttgtgcaagcaacaaaatggactccctgctcc
agaacatgtgggatgggaatatctaacagggtgaccaatgaaaacagcaactgtgaaatg
agaaaagagaaaagactgtgttacattcagccttgcgacagcaatatattaaagacaata
aagattcccaaaggaaaaacatgccaacctactttccaactctccaaagctgaaaaattt
gtcttttctggatgctcaagtactcagagttacaaacccactttttgtggaatatgcttg
gataagagatgctgtatccctaataagtctaaaatgattactattcaatttgattgccca
aatgaggggtcatttaaatggaagatgctgtggattacatcttgtgtgtgtcagagaaac
tgcagagaacctggagatatattttctgagctcaagattctgtaa

DBGET integrated database retrieval system