KEGG   Homo sapiens (human): 917Help
Entry
917               CDS       T01001                                 

Gene name
CD3G, CD3-GAMMA, IMD17, T3G
Definition
CD3g molecule, gamma (CD3-TCR complex)
Orthology
K06452  
T-cell surface glycoprotein CD3 gamma chain
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
T cell receptor signaling pathway
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Drug target
Catumaxomab: 
Muromonab-CD3: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    917 (CD3G)
   04660 T cell receptor signaling pathway
    917 (CD3G)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    917 (CD3G)
   05162 Measles
    917 (CD3G)
   05142 Chagas disease (American trypanosomiasis)
    917 (CD3G)
Cellular antigens [BR:hsa04090]
 Proteins
  917 (CD3G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q23
AA seq 182 aa AA seqDB search
MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGK
MIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLF
AEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLR
RN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaacaggggaagggcctggctgtcctcatcctggctatcattcttcttcaaggtact
ttggcccagtcaatcaaaggaaaccacttggttaaggtgtatgactatcaagaagatggt
tcggtacttctgacttgtgatgcagaagccaaaaatatcacatggtttaaagatgggaag
atgatcggcttcctaactgaagataaaaaaaaatggaatctgggaagtaatgccaaggac
cctcgagggatgtatcagtgtaaaggatcacagaacaagtcaaaaccactccaagtgtat
tacagaatgtgtcagaactgcattgaactaaatgcagccaccatatctggctttctcttt
gctgaaatcgtcagcattttcgtccttgctgttggggtctacttcattgctggacaggat
ggagttcgccagtcgagagcttcagacaagcagactctgttgcccaatgaccagctctac
cagcccctcaaggatcgagaagatgaccagtacagccaccttcaaggaaaccagttgagg
aggaattga

DBGET integrated database retrieval system