KEGG   Homo sapiens (human): 9211Help
Entry
9211              CDS       T01001                                 

Gene name
LGI1, ADLTE, ADPAEF, ADPEAF, EPITEMPIN, EPT, ETL1, IB1099
Definition
(RefSeq) leucine-rich, glioma inactivated 1
Organism
hsa  Homo sapiens (human)
Disease
H00809  
Autosomal dominant temporal lobe epilepsy (ADTLE)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24
AA seq 291 aa AA seqDB search
MESERSKRMGNACIPLKRIAYFLCLLSALLLTEGKKPAKPKCPAVCTCTKDNALCENARS
IPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYL
FIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCK
LKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSID
TFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITVLREIHRFTNMS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagaaagaagcaaaaggatgggaaatgcctgcattcccctgaaaagaattgct
tatttcctatgtctcttatctgcgcttttgctgactgaggggaagaaaccagcgaagcca
aaatgccctgccgtgtgtacttgtaccaaagataatgctttatgtgagaatgccagatcc
attccacgcaccgttcctcctgatgttatctcattatcctttgtgagatctggttttact
gaaatctcagaagggagttttttattcacgccatcgctgcagctcttgttattcacatcg
aactcctttgatgtgatcagtgatgatgcttttattggtcttccacatctagagtattta
ttcatagaaaacaacaacatcaagtcaatttcaagacatactttccggggactaaagtca
ttaattcacttgagccttgcaaacaacaatctccagacactcccaaaagatattttcaaa
ggcctggattctttaacaaatgtggacctgaggggtaattcatttaattgtgactgtaaa
ctgaaatggctagtggaatggcttggccacaccaatgcaactgttgaagacatctactgc
gaaggccccccagaatacaagaagcgcaaaatcaatagtctctcctcgaaggatttcgat
tgcatcattacagaatttgcaaagtctcaagacctgccttatcaatcattgtccatagac
actttttcttatttgaatgatgagtatgtagtcatcgctcagccttttactggaaaatgc
attttccttgaatgggaccatgtggaaaagaccttccggaattatgacaacattacagtt
ttaagggaaatacacagatttacaaacatgtcatag

DBGET integrated database retrieval system