KEGG   Homo sapiens (human): 9217Help
Entry
9217              CDS       T01001                                 

Gene name
VAPB, ALS8, VAMP-B, VAP-B
Definition
VAMP (vesicle-associated membrane protein)-associated protein B and C
Orthology
K10707  
vesicle-associated membrane protein-associated protein B
Organism
hsa  Homo sapiens (human)
Disease
H00058  
Amyotrophic lateral sclerosis (ALS)
H00455  
Spinal muscular atrophy (SMA)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.33
AA seq 99 aa AA seqDB search
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI
IDAGASINVSGRRWTADEEDSAEQQPHFSISPNWEGRRP
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggtggagcaggtcctgagcctcgagccgcagcacgagctcaaattccgaggt
cccttcaccgatgttgtcaccaccaacctaaagcttggcaacccgacagaccgaaatgtg
tgttttaaggtgaagactacagcaccacgtaggtactgtgtgaggcccaacagcggaatc
atcgatgcaggggcctcaattaatgtatctggaagaagatggactgcggatgaggaagac
agtgcagagcaacagccccatttcagcattagccccaactgggaaggaagaaggccttag

DBGET integrated database retrieval system