KEGG   Homo sapiens (human): 9343Help
Entry
9343              CDS       T01001                                 

Gene name
EFTUD2, MFDGA, MFDM, SNRNP116, Snrp116, Snu114, U5-116KD
Definition
(RefSeq) elongation factor Tu GTP binding domain containing 2
  KO
K12852  
116 kDa U5 small nuclear ribonucleoprotein component
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    9343 (EFTUD2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    9343 (EFTUD2)
 Complex C
   U5 SnRNP specific factors
    9343 (EFTUD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.31
AA seq 972 aa AA seqDB search
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atggataccgacttatatgatgagtttgggaattatattggaccagagcttgattctgat
gaagatgatgatgaattgggtagagagaccaaagatcttgatgagatggatgatgatgac
gacgacgatgacgtaggagatcatgacgatgaccaccctgggatggaggtggtgctgcat
gaggacaagaagtactacccaacagccgaggaggtgtatggtcctgaggtggagaccata
gttcaagaggaagacactcagcctctcacagaacccattattaagccagtgaaaaccaag
aaattcactctgatggagcagacattacctgttacggtgtatgagatggatttcttggcg
gatctgatggataactcagagctcatcagaaatgtgaccctttgtggacatctccaccat
ggcaagacatgttttgtggattgtttaattgaacagactcacccggaaatcagaaagcgc
tatgaccaagatctgtgctatactgacatcctcttcacagagcaagagagaggtgtaggc
atcaaaagcactcctgtgacagtggtcttgccagacaccaaaggaaaatcttatctcttc
aatatcatggacactccaggacatgtgaatttctctgatgaggtcacagctggcttgcgc
atctcagatggagtggtccttttcattgatgctgctgagggggtgatgctgaacacagag
cggctgatcaagcatgcggtgcaggagaggctggcagtcactgtgtgcatcaacaagatt
gaccggctgatcctggagctgaagctgcctccaactgatgcttattacaagctgcgccac
attgtggatgaggtcaatggattaataagcatgtattccactgatgagaacctgatcctt
tccccactcctgggtaacgtctgcttctccagctcccagtacagcatctgcttcacgctg
ggctcctttgccaagatctatgccgacacctttggtgacattaattaccaagaatttgct
aaaagactctggggtgacatctacttcaaccctaagacgcgaaagttcaccaaaaaggcc
ccaactagcagctcccagagaagtttcgtggagtttatcttggagcctctttataagatc
ctcgcccaggttgtaggtgacgtggacaccagcctcccacggaccctagacgagcttggc
atccacctgacgaaggaggagctgaagctgaacatccgccccttgctcaggctggtctgc
aaaaagttctttggcgagttcacaggctttgtggacatgtgtgtgcagcatatcccttct
ccaaaggtgggcgccaagcccaagattgagcacacctacaccggtggtgtggactccgac
ctcggcgaggctatgagtgactgtgaccctgatggccccctgatgtgccacactactaag
atgtacagcacagatgatggagtccagtttcacgcctttggccgggtgctgagtggcacc
attcatgctgggcagcctgtgaaggtactgggggagaactacaccctggaggatgaggaa
gactcccagatatgcaccgtgggccgcctttggatctctgtggccaggtaccacatcgag
gtgaaccgtgttcctgctggcaactgggttctgattgaaggtgttgatcaaccaattgtg
aagacagcaaccataaccgaaccccgaggcaatgaggaggctcagattttccgacccttg
aagttcaataccacatctgttatcaagattgctgtggagccagtcaacccctcagagctg
cccaagatgcttgatggcctgcgcaaggtcaacaagagctatccatccctcaccaccaag
gtggaggagtctggcgagcatgtgatcctgggcactggggagctctacctggactgtgtg
atgcatgatttgcggaagatgtactcagagatagacatcaaggtggctgacccagttgtc
acgttttgtgagacggtggtggaaacatcctccctcaagtgctttgctgaaacgcctaat
aagaagaacaagatcaccatgattgctgagcctcttgagaagggcctggcagaggacata
gagaatgaggtggtccagattacgtggaacaggaagaagctgggagagttcttccagacc
aagtacgattgggatctgctggctgcccgttccatctgggcttttggccctgatgcgact
ggccccaacattctggtggatgatactctgccctctgaggtggacaaggctcttcttggt
tcagtgaaggacagcatcgttcaaggtttccagtggggaaccagggagggccccctctgt
gatgaattgattcggaatgtcaagtttaagatcctggatgcggtggttgcccaggagccc
ctgcaccggggcgggggccagatcatccccacagccaggagagtcgtctactctgccttc
ctcatggctactcctcgtctgatggagccttactactttgtagaggtccaggcccctgca
gattgcgtctctgcagtttataccgtcctggccaggcgcagggggcacgtgactcaggat
gcacccatcccaggctcccctctgtacaccatcaaagcttttatcccggccatcgactct
tttggctttgagactgatctccggactcacacccagggacaagccttttctctgtctgtc
ttccaccactggcagattgtgcctggtgatcccctggacaagagcattgtcatccgcccc
ttggagccacagccagctcctcacctggcccgggaattcatgatcaaaacccgccgtagg
aagggcctcagtgaagatgtgagcatcagcaaattcttcgatgatcctatgttgctggaa
cttgccaaacaggatgttgtgctcaattaccccatgtga

DBGET integrated database retrieval system