KEGG   Homo sapiens (human): 9365Help
Entry
9365              CDS       T01001                                 

Gene name
KL
Definition
klotho (EC:3.2.1.31)
Orthology
K14756  
klotho [EC:3.2.1.31]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Endocrine and other factor-regulated calcium reabsorption
Module
Glucuronate pathway (uronate pathway)
Disease
H01193  
Familial tumoral calcinosis (FTC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    9365 (KL)
   00500 Starch and sucrose metabolism
    9365 (KL)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    9365 (KL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     9365 (KL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   9365 (KL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q12
AA seq 1012 aa AA seqDB search
MPASAPPRRPRPPPPSLSLLLVLLGLGGRRLRAEPGDGAQTWARFSRPPAPEAAGLFQGT
FPDGFLWAVGSAAYQTEGGWQQHGKGASIWDTFTHHPLAPPGDSRNASLPLGAPSPLQPA
TGDVASDSYNNVFRDTEALRELGVTHYRFSISWARVLPNGSAGVPNREGLRYYRRLLERL
RELGVQPVVTLYHWDLPQRLQDAYGGWANRALADHFRDYAELCFRHFGGQVKYWITIDNP
YVVAWHGYATGRLAPGIRGSPRLGYLVAHNLLLAHAKVWHLYNTSFRPTQGGQVSIALSS
HWINPRRMTDHSIKECQKSLDFVLGWFAKPVFIDGDYPESMKNNLSSILPDFTESEKKFI
KGTADFFALCFGPTLSFQLLDPHMKFRQLESPNLRQLLSWIDLEFNHPQIFIVENGWFVS
GTTKRDDAKYMYYLKKFIMETLKAIKLDGVDVIGYTAWSLMDGFEWHRGYSIRRGLFYVD
FLSQDKMLLPKSSALFYQKLIEKNGFPPLPENQPLEGTFPCDFAWGVVDNYIQVDTTLSQ
FTDLNVYLWDVHHSKRLIKVDGVVTKKRKSYCVDFAAIQPQIALLQEMHVTHFRFSLDWA
LILPLGNQSQVNHTILQYYRCMASELVRVNITPVVALWQPMAPNQGLPRLLARQGAWENP
YTALAFAEYARLCFQELGHHVKLWITMNEPYTRNMTYSAGHNLLKAHALAWHVYNEKFRH
AQNGKISIALQADWIEPACPFSQKDKEVAERVLEFDIGWLAEPIFGSGDYPWVMRDWLNQ
RNNFLLPYFTEDEKKLIQGTFDFLALSHYTTILVDSEKEDPIKYNDYLEVQEMTDITWLN
SPSQVAVVPWGLRKVLNWLKFKYGDLPMYIISNGIDDGLHAEDDQLRVYYMQNYINEALK
AHILDGINLCGYFAYSFNDRTAPRFGLYRYAADQFEPKASMKHYRKIIDSNGFPGPETLE
RFCPEEFTVCTECSFFHTRKSLLAFIAFLFFASIISLSLIFYYSKKGRRSYK
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccagcgccccgccgcgccgcccgcggccgccgccgccgtcgctgtcgctgctg
ctggtgctgctgggcctgggcggccgccgcctgcgtgcggagccgggcgacggcgcgcag
acctgggcccgtttctcgcggcctcctgcccccgaggccgcgggcctcttccagggcacc
ttccccgacggcttcctctgggccgtgggcagcgccgcctaccagaccgagggcggctgg
cagcagcacggcaagggtgcgtccatctgggatacgttcacccaccaccccctggcaccc
ccgggagactcccggaacgccagtctgccgttgggcgccccgtcgccgctgcagcccgcc
accggggacgtagccagcgacagctacaacaacgtcttccgcgacacggaggcgctgcgc
gagctcggggtcactcactaccgcttctccatctcgtgggcgcgagtgctccccaatggc
agcgcgggcgtccccaaccgcgaggggctgcgctactaccggcgcctgctggagcggctg
cgggagctgggcgtgcagcccgtggtcaccctgtaccactgggacctgccccagcgcctg
caggacgcctacggcggctgggccaaccgcgccctggccgaccacttcagggattacgcg
gagctctgcttccgccacttcggcggtcaggtcaagtactggatcaccatcgacaacccc
tacgtggtggcctggcacggctacgccaccgggcgcctggcccccggcatccggggcagc
ccgcggctcgggtacctggtggcgcacaacctcctcctggctcatgccaaagtctggcat
ctctacaatacttctttccgtcccactcagggaggtcaggtgtccattgccctaagctct
cactggatcaatcctcgaagaatgaccgaccacagcatcaaagaatgtcaaaaatctctg
gactttgtactaggttggtttgccaaacccgtatttattgatggtgactatcccgagagc
atgaagaataacctttcatctattctgcctgattttactgaatctgagaaaaagttcatc
aaaggaactgctgacttttttgctctttgctttggacccaccttgagttttcaacttttg
gaccctcacatgaagttccgccaattggaatctcccaacctgaggcaactgctttcctgg
attgaccttgaatttaaccatcctcaaatatttattgtggaaaatggctggtttgtctca
gggaccaccaagagagatgatgccaaatatatgtattacctcaaaaagttcatcatggaa
accttaaaagccatcaagctggatggggtggatgtcatcgggtataccgcatggtccctc
atggatggtttcgagtggcacagaggttacagcatcaggcgtggactcttctatgttgac
tttctaagccaggacaagatgttgttgccaaagtcttcagccttgttctaccaaaagctg
atagagaaaaatggcttccctcctttacctgaaaatcagcccctagaagggacatttccc
tgtgactttgcttggggagttgttgacaactacattcaagtagataccactctgtctcag
tttaccgacctgaatgtttacctgtgggatgtccaccacagtaaaaggcttattaaagtg
gatggggttgtgaccaagaagaggaaatcctactgtgttgactttgctgccatccagccc
cagatcgctttactccaggaaatgcacgttacacattttcgcttctccctggactgggcc
ctgattctccctctgggtaaccagtcccaggtgaaccacaccatcctgcagtactatcgc
tgcatggccagcgagcttgtccgtgtcaacatcaccccagtggtggccctgtggcagcct
atggccccgaaccaaggactgccgcgcctcctggccaggcagggcgcctgggagaacccc
tacactgccctggcctttgcagagtatgcccgactgtgctttcaagagctcggccatcac
gtcaagctttggataacgatgaatgagccgtatacaaggaatatgacatacagtgctggc
cacaaccttctgaaggcccatgccctggcttggcatgtgtacaatgaaaagtttaggcat
gctcagaatgggaaaatatccatagccttgcaggctgattggatagaacctgcctgccct
ttctcccaaaaggacaaagaggtggctgagagagttttggaatttgacattggctggctg
gctgagcccattttcggctctggagattatccatgggtgatgagggactggctgaaccaa
agaaacaattttcttcttccttatttcactgaagatgaaaaaaagctaatccagggtacc
tttgactttttggctttaagccattataccaccatccttgtagactcagaaaaagaagat
ccaataaaatacaatgattacctagaagtgcaagaaatgaccgacatcacgtggctcaac
tcccccagtcaggtggcggtagtgccctgggggttgcgcaaagtgctgaactggctgaag
ttcaagtacggagacctccccatgtacataatatccaatggaatcgatgacgggctgcat
gctgaggacgaccagctgagggtgtattatatgcagaattacataaacgaagctctcaaa
gcccacatactggatggtatcaatctttgcggatactttgcttattcgtttaacgaccgc
acagctccgaggtttggcctctatcgttatgctgcagatcagtttgagcccaaggcatcc
atgaaacattacaggaaaattattgacagcaatggtttcccgggcccagaaactctggaa
agattttgtccagaagaattcaccgtgtgtactgagtgcagtttttttcacacccgaaag
tctttactggctttcatagcttttctattttttgcttctattatttctctctcccttata
ttttactactcgaagaaaggcagaagaagttacaaatag

DBGET integrated database retrieval system