KEGG   Homo sapiens (human): 9398Help
Entry
9398              CDS       T01001                                 

Gene name
CD101, EWI-101, IGSF2, V7
Definition
(RefSeq) CD101 molecule
  KO
K06522  immunoglobulin superfamily, member 2/3
Organism
hsa  Homo sapiens (human)
Brite
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   9398 (CD101)
CD molecules [BR:hsa04090]
 Proteins
  9398 (CD101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 C2-set
Motif
Other DBs
NCBI-GeneID: 9398
NCBI-ProteinID: NP_001243035
OMIM: 604516
HGNC: 5949
Ensembl: ENSG00000134256
Vega: OTTHUMG00000012029
Pharos: Q93033(Tbio)
UniProt: Q93033
Position
1p13.1
AA seq 1021 aa AA seqDB search
MAGISYVASFFLLLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQGPSEQHFQWSV
YLPTNPTQEVQIISTKDAAFSYAVYTQRVRSGDVYVERVQGNSVLLHISKLQMKDAGEYE
CHTPNTDEKYYGSYSAKTNLIVIPDTLSATMSSQTLGKEEGEPLALTCEASKATAQHTHL
SVTWYLTQDGGGSQATEIISLSKDFILVPGPLYTERFAASDVQLNKLGPTTFRLSIERLQ
SSDQGQLFCEATEWIQDPDETWMFITKKQTDQTTLRIQPAVKDFQVNITADSLFAEGKPL
ELVCLVVSSGRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGELQVSKLGPKAF
SLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPDSHVHLRKPAARSVVMSTKNK
QQVVWEGETLAFLCKAGGAESPLSVSWWHIPRDQTQPEFVAGMGQDGIVQLGASYGVPSY
HGNTRLEKMDWATFQLEITFTAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESS
LQVSLMSRQPQVMLTNTFDLSCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGT
IEWGNFLSRFQKKTKVSQSLFRSQLLVHDATEEETGVYQCEVEVYDRNSLYNNRPPRASA
ISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVST
NASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQDLFQLHILNVEDSDRGKYHCAV
EEWLLSTNGTWHKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVG
SSATLYSVMWYWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVE
MEDAGMYWCRVAEWQLHGHPSKWINQASDESQRMVLTVLPSEPTLPSRICSSAPLLYFLF
ICPFVLLLLLLISLLCLYWKARKLSTLRSNTRKEKALWVDLKEAGGVTTNRREDEEEDEG
N
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcatctcatatgtggcatctttctttctccttctgactaagctcagcattggc
cagagagaagtaacagttcagaaaggaccactgtttagagctgaaggttacccagtcagc
attggctgcaatgtaactggccaccagggaccttctgagcagcatttccagtggtctgtt
tacctgccgacaaacccgacccaggaagtccagatcattagcaccaaggatgctgccttc
tcttacgcagtatatacgcagcgggtgcgaagcggagacgtctacgtggagagggtccag
ggcaactcagtcttgttgcacatctcaaaactccagatgaaggatgctggcgagtatgag
tgtcacacaccaaacactgatgagaaatactatggaagttacagtgcaaagactaatcta
attgttattccagataccctctctgccaccatgagttctcagactctcggtaaggaggaa
ggtgagccattagccctcacctgtgaggcatccaaagccacagcccaacatactcacctc
tctgtcacctggtacctaacacaggatggaggaggaagccaagccactgagattatttct
ctctccaaagattttatattggtccctgggcccttgtatacagagcggtttgcagccagt
gacgtacagctcaacaaactgggacccactacattcaggctgtccatagagaggctccag
tcctcagatcagggtcagctgttctgtgaggcaacggaatggattcaggatccagatgaa
acttggatgttcatcaccaaaaagcagaccgatcaaaccactctgaggatccagccagca
gtgaaagattttcaagtcaacattacagctgacagcttgtttgctgaagggaaaccctta
gaactggtttgcctggttgtaagcagtggccgtgacccacagcttcaaggcatttggttc
ttcaatgggactgaaattgctcacattgatgctggtggagtcctgggcctgaagaatgac
tacaaagagagagcaagtcaaggagagctccaggtttcaaagttaggccccaaggctttc
tctctcaagatcttctctctgggcccagaggatgaaggcgcctacagatgtgtggtagca
gaggtcatgaaaacacgcacaggttcctggcaggtgcttcagagaaagcagtcaccagac
agccacgtgcacctgaggaagccagcagcaagaagtgtggtcatgtctaccaagaacaag
cagcaagttgtgtgggaaggagagacactcgcctttctctgtaaggctggtggagctgaa
agtcccctgtctgtgagctggtggcacatcccacgggaccagacacagcccgagtttgtg
gctggcatggggcaggatggcattgtgcagctgggtgcctcctatggggtacccagttac
catggcaacacaaggctggagaaaatggactgggccaccttccagctggagatcaccttc
actgccatcacagacagtggcacatatgagtgcagagtatctgagaagtctcggaaccag
gccagagatctgagctggactcagaagatttcagttactgtaaagtctctggagtcaagt
ttacaagttagtctgatgagccgtcagccgcaagtgatgttaaccaacacctttgacctg
tcctgtgtcgtgagggccggttactctgacctcaaggtgccactcactgtgacgtggcag
ttccagccagctagctctcacatcttccaccagcttattcgaatcacccacaatggcact
attgaatgggggaatttcctatcccggttccaaaagaagacgaaagtgtcgcagtcttta
tttcgttcacaactcctagtccatgatgccactgaggaagagacaggagtgtatcagtgt
gaagtagaagtttatgacagaaattccctatacaacaaccgccccccgagggcttctgcc
atctctcacccactgaggatagccgtcactttaccagagagcaagctaaaagtgaattca
aggagtcaagtccaagagctctccatcaactccaacactgatatagaatgtagcatcttg
tcccggtccaatggaaaccttcagttagccattatttggtatttttctcctgtttccact
aatgcctcttggctaaagatcctggagatggaccaaaccaatgttataaaaactggggat
gagtttcacaccccacagagaaaacaaaaatttcatactgagaaggtttcccaagactta
tttcagctgcacattctgaatgtggaagacagcgatcggggcaaatatcactgtgctgtg
gaggaatggctcctgtctacaaatggcacttggcacaagcttggagaaaagaagtcagga
ctaacagaattgaaactcaagcccacaggaagtaaggtacgtgtctccaaagtgtactgg
accgaaaatgtgactgagcacagagaagtggccatccgctgcagcctggagagtgtaggc
agctcagccactctgtactctgtgatgtggtactggaacagagaaaactctggaagtaaa
ttgctggtgcacttgcaacatgatggcttgctggagtatggggaagaggggctcaggagg
cacctgcactgttaccgttcatcctctacagactttgtcctgaagcttcatcaggtggag
atggaggatgcaggaatgtactggtgtagggtggcagagtggcagctccatggacaccca
agcaagtggattaatcaagcatccgatgagtcacagcggatggtgctcacggtgctgcct
tcagagcccacgcttccttccaggatctgctcctcggcccctttactctatttcctgttc
atctgtcccttcgtcctgctcctccttctgctcatctccctcctctgcttatactggaag
gccaggaagttgtcaacactgcgttccaacacacggaaagaaaaagctctctgggtggac
ttgaaagaggctggaggtgtgaccacaaataggagggaagacgaggaggaagatgaaggc
aactga

DBGET integrated database retrieval system