KEGG   Homo sapiens (human): 93986Help
Entry
93986             CDS       T01001                                 

Gene name
FOXP2, CAGH44, SPCH1, TNRC10
Definition
forkhead box P2
Orthology
K09409  
forkhead box protein P
Organism
hsa  Homo sapiens (human)
Disease
H00902  
Speech-language disorder 1 (SPCH1)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31
AA seq 714 aa AA seqDB search
MMQESATETISNSSMNQNGMSTLSSQLDAGSRDGRSSGDTSSEVSTVELLHLQQQQALQA
ARQLLLQQQTSGLKSPKSSDKQRPLQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQA
LLQQQQAVMLQQQQLQEFYKKQQEQLHLQLLQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQHPGKQAKEQQQQQQQQQLAAQQLVFQQQLLQMQQLQQQQHLLSLQRQGL
ISIPPGQAALPVQSLPQAGLSPAEIQQLWKEVTGVHSMEDNGIKHGGLDLTTNNSSSTTS
SNTSKASPPITHHSIVNGQSSVLSARRDSSSHEETGASHTLYGHGVCKWPGCESICEDFG
QFLKHLNNEHALDDRSTAQCRVQMQVVQQLEIQLSKERERLQAMMTHLHMRPSEPKPSPK
PLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTPITQGPSVITPASVPNVGAIRRRHSD
KYNIPMSSEIAPNYEFYKNADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYF
RRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVEYQKRRSQKITGSPTLVKNIPTS
LGYGAALNASLQAALAESSLPLLSNPGLINNASSGLLQAVHEDLNGSLDHIDSNGNSSPG
CSPQPHIHSIHVKEEPVIAEDEDCPMSLVTTANHSPELEDDREIEEEPLSEDLE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggaatctgcgacagagacaataagcaacagttcaatgaatcaaaatggaatg
agcactctaagcagccaattagatgctggcagcagagatggaagatcaagtggtgacacc
agctctgaagtaagcacagtagaactgctgcatctgcaacaacagcaggctctccaggca
gcaagacaacttcttttacagcagcaaacaagtggattgaaatctcctaagagcagtgat
aaacagagaccactgcaggtgcctgtgtcagtggccatgatgactccccaggtgatcacc
cctcagcaaatgcagcagatccttcagcaacaagtcctgtctcctcagcagctacaagcc
cttctccaacaacagcaggctgtcatgctgcagcagcaacaactacaagagttttacaag
aaacagcaagagcagttacatcttcagcttttgcagcagcagcagcaacagcagcagcag
caacaacagcagcaacaacagcagcagcaacaacaacaacaacagcagcaacaacagcag
cagcagcagcaacagcagcagcagcagcaacagcatcctggaaagcaagcgaaagagcag
cagcagcagcagcagcaacagcaattggcagcccagcagcttgtcttccagcagcagctt
ctccagatgcaacaactccagcagcagcagcatctgctcagccttcagcgtcagggactc
atctccattccacctggccaggcagcacttcctgtccaatcgctgcctcaagctggctta
agtcctgctgagattcagcagttatggaaagaagtgactggagttcacagtatggaagac
aatggcattaaacatggagggctagacctcactactaacaattcctcctcgactacctcc
tccaacacttccaaagcatcaccaccaataactcatcattccatagtgaatggacagtct
tcagttctaagtgcaagacgagacagctcgtcacatgaggagactggggcctctcacact
ctctatggccatggagtttgcaaatggccaggctgtgaaagcatttgtgaagattttgga
cagtttttaaagcaccttaacaatgaacacgcattggatgaccgaagcactgctcagtgt
cgagtgcaaatgcaggtggtgcaacagttagaaatacagctttctaaagaacgcgaacgt
cttcaagcaatgatgacccacttgcacatgcgaccctcagagcccaaaccatctcccaaa
cctctaaatctggtgtctagtgtcaccatgtcgaagaatatgttggagacatccccacag
agcttacctcaaacccctaccacaccaacggccccagtcaccccgattacccagggaccc
tcagtaatcaccccagccagtgtgcccaatgtgggagccatacgaaggcgacattcagac
aaatacaacattcccatgtcatcagaaattgccccaaactatgaattttataaaaatgca
gatgtcagacctccatttacttatgcaactctcataaggcaggctatcatggagtcatct
gacaggcagttaacacttaatgaaatttacagctggtttacacggacatttgcttacttc
aggcgtaatgcagcaacttggaagaatgcagtacgtcataatcttagcctgcacaagtgt
tttgttcgagtagaaaatgttaaaggagcagtatggactgtggatgaagtagaataccag
aagcgaaggtcacaaaagataacaggaagtccaaccttagtaaaaaatatacctaccagt
ttaggctatggagcagctcttaatgccagtttgcaggctgccttggcagagagcagttta
cctttgctaagtaatcctggactgataaataatgcatccagtggcctactgcaggccgtc
cacgaagacctcaatggttctctggatcacattgacagcaatggaaacagtagtccgggc
tgctcacctcagccgcacatacattcaatccacgtcaaggaagagccagtgattgcagag
gatgaagactgcccaatgtccttagtgacaacagctaatcacagtccagaattagaagac
gacagagagattgaagaagagcctttatctgaagatctggaatga

DBGET integrated database retrieval system