KEGG   Homo sapiens (human): 9401Help
Entry
9401              CDS       T01001                                 

Gene name
RECQL4, RECQ4
Definition
RecQ protein-like 4 (EC:3.6.4.12)
Orthology
K10730  
ATP-dependent DNA helicase Q4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Disease
H00296  
Defects in RecQ helicases
H00458  
Craniosynostosis
H00965  
RAPADILINO syndrome
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     9401 (RECQL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 1208 aa AA seqDB search
MERLRDVRERLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRTTGQAGGGLR
SSESLPAAAEEAPEPRCWGPHLNRAATKSPQPTPGRSRQGSVPDYGQRLKANLKGTLQAG
PALGRRPWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQHLQASLS
QRLGSLDPGWLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEAS
AFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPG
EPVQAQPPQPCSSPSNPRYHGLSPSSQARAGKAEGTAPLHIFPRLARHDRGNYVRLNMKQ
KHYVRGRALRSRLLRKQAWKQKWRKKGECFGGGGATVTTKESCFLNEQFDHWAAQCPRPA
SEEDTDAVGPEPLVPSPQPVPEVPSLDPTVLPLYSLGPSGQLAETPAEVFQALEQLGHQA
FRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYSRRSPCLTLVVSPLLSLMDDQ
VSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLTPEALVGAGGLPPAAQLPPVA
FACIDEAHCLSQWSHNFRPCYLRVCKVLRERMGVHCFLGLTATATRRTASDVAQHLAVAE
EPDLHGPAPVPTNLHLSVSMDRDTDQALLTLLQGKRFQNLDSIIIYCNRREDTERIAALL
RTCLHAAWVPGSGGRAPKTTAEAYHAGMCSRERRRVQRAFMQGQLRVVVATVAFGMGLDR
PDVRAVLHLGLPPSFESYVQAVGRAGRDGQPAHCHLFLQPQGEDLRELRRHVHADSTDFL
AVKRLVQRVFPACTCTCTRPPSEQEGAVGGERPVPKYPPQEAEQLSHQAAPGPRRVCMGH
ERALPIQLTVQALDMPEEAIETLLCYLELHPHHWLELLATTYTHCRLNCPGGPAQLQALA
HRCPPLAVCLAQQLPEDPGQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGV
RRGTGVLVEFSELAFHLRSPGDLTAEEKDQICDFLYGRVQARERQALARLRRTFQAFHSV
AFPSCGPCLEQQDEERSTRLKDLLGRYFEEEEGQEPGGMEDAQGPEPGQARLQDWEDQVR
CDIRQFLSLRPEEKFSSRAVARIFHGIGSPCYPAQVYGQDRRFWRKYLHLSFHALVGLAT
EELLQVAR
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggagcggctgcgggacgtgcgggagcggctgcaggcgtgggagcgcgcgttccgacgg
cagcgcgggcggcgaccgagccaggacgacgtggaggcggcgccggaggagacccgcgcg
ctctaccgggaataccgcactctgaagcgtaccacgggccaggccggcggcgggctccgc
agctccgagtcgctccccgcggcggccgaagaggcgccagagccccgctgctgggggccc
catctgaatcgggctgcgaccaagagtccacagcctacgccagggcggagccgccagggc
tcggtgccggactacgggcagcggctcaaggccaatctgaaaggcaccctgcaggccgga
ccagccctgggccgcagaccgtggcctctaggaagagcctcatctaaggcatccacccca
aagcccccaggtacagggcctgtcccctcctttgcagaaaaagtcagtgatgagcctcca
cagctccctgagccccagccaaggccaggccggctccagcatctgcaggcatccctgagc
cagcggctgggctccctagatcctggctggttacagcgatgtcacagtgaggtcccagat
tttctgggggcccccaaagcctgcaggcctgatctaggctcagaggaatcacaacttctg
atccctggtgagtcggctgtccttggtcctggtgctggctcccagggcccagaggcttca
gccttccaagaagtcagcatccgtgtggggagcccccagcccagcagcagtggaggcgag
aagcggagatggaacgaggagccctgggagagccccgcacaggtccagcaggagagcagc
caagctggacccccatcggagggggctggggctgtagcagttgaggaagaccctccaggg
gaacctgtacaggcacagccacctcagccctgcagcagcccatcgaaccccaggtaccac
ggactcagcccctccagtcaagctagggctgggaaggctgagggcacagcccccctgcac
atcttccctcggctggcccgccatgacaggggcaattacgtacggctcaacatgaagcag
aaacactacgtgcggggccgggcactccgtagcaggctcctccgcaagcaggcatggaag
cagaagtggcggaagaaaggggagtgttttgggggtggtggtgccacagtcacaaccaag
gagtcttgtttcctgaacgagcagttcgatcactgggcagcccagtgtccccggccagca
agtgaggaagacacagatgctgttgggcctgagccactggttccttcaccacaacctgta
cctgaggtgcccagcctggaccccaccgtgctgccactctactccctggggccctcaggg
cagttggcagagacgccggctgaggtgttccaggccctggagcagctggggcaccaagcc
tttcgccctgggcaggagcgtgcagtcatgcggatcctgtctggcatctccacgctgctg
gtgctgcctacaggtgccggcaagtccctgtgctaccagctcccagcgctgctctacagc
cggcgcagcccctgcctcacgttggtcgtctctcccctgctgtcactcatggatgaccag
gtgtctggcctgccaccgtgtctcaaggcggcctgcatacactcgggcatgaccaggaag
caacgggaatctgtcctgcagaagattcgggcagcccaggtacacgtgctgatgctgaca
cctgaggcactggtgggggcgggaggcctccctccagccgcacagctgcctccagttgct
tttgcctgcattgatgaggcccactgcctctcccagtggtcccacaacttccggccctgc
tacctgcgcgtctgcaaggtgcttcgggagcgcatgggcgtgcactgcttcctgggcctc
acagccacagccacacgccgcactgccagtgacgtggcacagcacctggctgtggctgaa
gagcctgacctccacgggccagccccagttcccaccaacctgcacctttccgtgtccatg
gacagggacacagaccaggcactgttgacgctgctgcaaggcaaacgttttcaaaacctc
gattccattatcatttactgcaaccggcgcgaggacacagagcggatcgctgcgctcctc
cgaacctgcctgcacgcagcctgggtcccagggtctggaggtcgtgcccccaaaaccaca
gccgaggcctaccacgcgggcatgtgcagccgggaacggcggcgggtacagcgagccttc
atgcagggccagttgcgggtggtggtggccacggtggcctttgggatggggctggaccgg
ccagatgtgcgggctgtgctgcatctggggctgcccccaagcttcgagagctacgtgcag
gccgtgggccgggccgggcgtgacgggcagcctgcccactgccacctcttcctgcagccc
cagggcgaagacctgcgagagctgcgcagacatgtgcacgccgacagcacggacttcctg
gctgtgaagaggctggtacagcgcgtgttcccagcctgcacctgcacctgcaccaggccg
ccctcggagcaggaaggggccgtgggtggggagaggcctgtgcccaagtacccccctcaa
gaggctgagcagcttagccaccaagcagccccaggacccagaagggtctgcatgggccat
gagcgggcactcccaatacagcttaccgtacaggctttggacatgccggaggaggccatc
gagactttgctgtgctacctggagctgcacccacaccactggctggagctgctggcgacc
acctatacccattgccgtctgaactgccctgggggccctgcccagctccaggccctggcc
cacaggtgtccccctttggctgtgtgcttggcccagcagctgcctgaggacccagggcaa
ggcagcagctccgtggagtttgacatggtcaagctggtggactccatgggctgggagctg
gcctctgtgcggcgggctctctgccagctgcagtgggaccacgagcccaggacaggtgtg
cggcgtgggacaggggtgcttgtggagttcagtgagctggccttccaccttcgcagcccg
ggggacctgaccgctgaggagaaggaccagatatgtgacttcctctatggccgtgtgcag
gcccgggagcgccaggccctggcccgtctgcgcagaaccttccaggcctttcacagcgta
gccttccccagctgcgggccctgcctggagcagcaggatgaggagcgcagcaccaggctc
aaggacctgctcggccgctactttgaggaagaggaagggcaggagccgggaggcatggag
gacgcacagggccccgagccagggcaggccagactccaggattgggaggaccaggtccgc
tgcgacatccgccagttcctgtccctgaggccagaggagaagttctccagcagggctgtg
gcccgcatcttccacggcatcggaagcccctgctacccggcccaggtgtacgggcaggac
cgacgcttctggagaaaatacctgcacctgagcttccatgccctggtgggcctggccacg
gaagagctcctgcaggtggcccgctga

DBGET integrated database retrieval system