KEGG   Homo sapiens (human): 9401Help
Entry
9401              CDS       T01001                                 

Gene name
RECQL4, RECQ4
Definition
RecQ protein-like 4 (EC:3.6.4.12)
Orthology
K10730  
ATP-dependent DNA helicase Q4 [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Disease
H00296  
Defects in RecQ helicases
H00458  
Craniosynostosis
H00965  
RAPADILINO syndrome
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 1208 aa AA seqDB search
MERLRDVRERLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRTTGQAGGGLR
SSESLPAAAEEAPEPRCWGPHLNRAATKSPQPTPGRSRQGSVPDYGQRLKANLKGTLQAG
PALGRRPWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQHLQASLS
QRLGSLDPGWLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEAS
AFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPG
EPVQAQPPQPCSSPSNPRYHGLSPSSQARAGKAEGTAPLHIFPRLARHDRGNYVRLNMKQ
KHYVRGRALRSRLLRKQAWKQKWRKKGECFGGGGATVTTKESCFLNEQFDHWAAQCPRPA
SEEDTDAVGPEPLVPSPQPVPEVPSLDPTVLPLYSLGPSGQLAETPAEVFQALEQLGHQA
FRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYSRRSPCLTLVVSPLLSLMDDQ
VSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLTPEALVGAGGLPPAAQLPPVA
FACIDEAHCLSQWSHNFRPCYLRVCKVLRERMGVHCFLGLTATATRRTASDVAQHLAVAE
EPDLHGPAPVPTNLHLSVSMDRDTDQALLTLLQGKRFQNLDSIIIYCNRREDTERIAALL
RTCLHAAWVPGSGGRAPKTTAEAYHAGMCSRERRRVQRAFMQGQLRVVVATVAFGMGLDR
PDVRAVLHLGLPPSFESYVQAVGRAGRDGQPAHCHLFLQPQGEDLRELRRHVHADSTDFL
AVKRLVQRVFPACTCTCTRPPSEQEGAVGGERPVPKYPPQEAEQLSHQAAPGPRRVCMGH
ERALPIQLTVQALDMPEEAIETLLCYLELHPHHWLELLATTYTHCRLNCPGGPAQLQALA
HRCPPLAVCLAQQLPEDPGQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGV
RRGTGVLVEFSELAFHLRSPGDLTAEEKDQICDFLYGRVQARERQALARLRRTFQAFHSV
AFPSCGPCLEQQDEERSTRLKDLLGRYFEEEEGQEPGGMEDAQGPEPGQARLQDWEDQVR
CDIRQFLSLRPEEKFSSRAVARIFHGIGSPCYPAQVYGQDRRFWRKYLHLSFHALVGLAT
EELLQVAR
NT seq 3627 nt NT seq  +upstreamnt  +downstreamnt
atggagcggctgcgggacgtgcgggagcggctgcaggcgtgggagcgcgcgttccgacgg
cagcgcgggcggcgaccgagccaggacgacgtggaggcggcgccggaggagacccgcgcg
ctctaccgggaataccgcactctgaagcgtaccacgggccaggccggcggcgggctccgc
agctccgagtcgctccccgcggcggccgaagaggcgccagagccccgctgctgggggccc
catctgaatcgggctgcgaccaagagtccacagcctacgccagggcggagccgccagggc
tcggtgccggactacgggcagcggctcaaggccaatctgaaaggcaccctgcaggccgga
ccagccctgggccgcagaccgtggcctctaggaagagcctcatctaaggcatccacccca
aagcccccaggtacagggcctgtcccctcctttgcagaaaaagtcagtgatgagcctcca
cagctccctgagccccagccaaggccaggccggctccagcatctgcaggcatccctgagc
cagcggctgggctccctagatcctggctggttacagcgatgtcacagtgaggtcccagat
tttctgggggcccccaaagcctgcaggcctgatctaggctcagaggaatcacaacttctg
atccctggtgagtcggctgtccttggtcctggtgctggctcccagggcccagaggcttca
gccttccaagaagtcagcatccgtgtggggagcccccagcccagcagcagtggaggcgag
aagcggagatggaacgaggagccctgggagagccccgcacaggtccagcaggagagcagc
caagctggacccccatcggagggggctggggctgtagcagttgaggaagaccctccaggg
gaacctgtacaggcacagccacctcagccctgcagcagcccatcgaaccccaggtaccac
ggactcagcccctccagtcaagctagggctgggaaggctgagggcacagcccccctgcac
atcttccctcggctggcccgccatgacaggggcaattacgtacggctcaacatgaagcag
aaacactacgtgcggggccgggcactccgtagcaggctcctccgcaagcaggcatggaag
cagaagtggcggaagaaaggggagtgttttgggggtggtggtgccacagtcacaaccaag
gagtcttgtttcctgaacgagcagttcgatcactgggcagcccagtgtccccggccagca
agtgaggaagacacagatgctgttgggcctgagccactggttccttcaccacaacctgta
cctgaggtgcccagcctggaccccaccgtgctgccactctactccctggggccctcaggg
cagttggcagagacgccggctgaggtgttccaggccctggagcagctggggcaccaagcc
tttcgccctgggcaggagcgtgcagtcatgcggatcctgtctggcatctccacgctgctg
gtgctgcctacaggtgccggcaagtccctgtgctaccagctcccagcgctgctctacagc
cggcgcagcccctgcctcacgttggtcgtctctcccctgctgtcactcatggatgaccag
gtgtctggcctgccaccgtgtctcaaggcggcctgcatacactcgggcatgaccaggaag
caacgggaatctgtcctgcagaagattcgggcagcccaggtacacgtgctgatgctgaca
cctgaggcactggtgggggcgggaggcctccctccagccgcacagctgcctccagttgct
tttgcctgcattgatgaggcccactgcctctcccagtggtcccacaacttccggccctgc
tacctgcgcgtctgcaaggtgcttcgggagcgcatgggcgtgcactgcttcctgggcctc
acagccacagccacacgccgcactgccagtgacgtggcacagcacctggctgtggctgaa
gagcctgacctccacgggccagccccagttcccaccaacctgcacctttccgtgtccatg
gacagggacacagaccaggcactgttgacgctgctgcaaggcaaacgttttcaaaacctc
gattccattatcatttactgcaaccggcgcgaggacacagagcggatcgctgcgctcctc
cgaacctgcctgcacgcagcctgggtcccagggtctggaggtcgtgcccccaaaaccaca
gccgaggcctaccacgcgggcatgtgcagccgggaacggcggcgggtacagcgagccttc
atgcagggccagttgcgggtggtggtggccacggtggcctttgggatggggctggaccgg
ccagatgtgcgggctgtgctgcatctggggctgcccccaagcttcgagagctacgtgcag
gccgtgggccgggccgggcgtgacgggcagcctgcccactgccacctcttcctgcagccc
cagggcgaagacctgcgagagctgcgcagacatgtgcacgccgacagcacggacttcctg
gctgtgaagaggctggtacagcgcgtgttcccagcctgcacctgcacctgcaccaggccg
ccctcggagcaggaaggggccgtgggtggggagaggcctgtgcccaagtacccccctcaa
gaggctgagcagcttagccaccaagcagccccaggacccagaagggtctgcatgggccat
gagcgggcactcccaatacagcttaccgtacaggctttggacatgccggaggaggccatc
gagactttgctgtgctacctggagctgcacccacaccactggctggagctgctggcgacc
acctatacccattgccgtctgaactgccctgggggccctgcccagctccaggccctggcc
cacaggtgtccccctttggctgtgtgcttggcccagcagctgcctgaggacccagggcaa
ggcagcagctccgtggagtttgacatggtcaagctggtggactccatgggctgggagctg
gcctctgtgcggcgggctctctgccagctgcagtgggaccacgagcccaggacaggtgtg
cggcgtgggacaggggtgcttgtggagttcagtgagctggccttccaccttcgcagcccg
ggggacctgaccgctgaggagaaggaccagatatgtgacttcctctatggccgtgtgcag
gcccgggagcgccaggccctggcccgtctgcgcagaaccttccaggcctttcacagcgta
gccttccccagctgcgggccctgcctggagcagcaggatgaggagcgcagcaccaggctc
aaggacctgctcggccgctactttgaggaagaggaagggcaggagccgggaggcatggag
gacgcacagggccccgagccagggcaggccagactccaggattgggaggaccaggtccgc
tgcgacatccgccagttcctgtccctgaggccagaggagaagttctccagcagggctgtg
gcccgcatcttccacggcatcggaagcccctgctacccggcccaggtgtacgggcaggac
cgacgcttctggagaaaatacctgcacctgagcttccatgccctggtgggcctggccacg
gaagagctcctgcaggtggcccgctga

DBGET integrated database retrieval system