KEGG   Homo sapiens (human): 9451Help
Entry
9451              CDS       T01001                                 

Gene name
EIF2AK3, PEK, PERK, WRS
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  
eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Disease
H00512  
Permanent neonatal diabetes mellitus (PNDM)
H00766  
Wolcott-Rallison syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    9451 (EIF2AK3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    9451 (EIF2AK3)
  Cell growth and death
   04210 Apoptosis
    9451 (EIF2AK3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    9451 (EIF2AK3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    9451 (EIF2AK3)
  Infectious diseases
   05162 Measles
    9451 (EIF2AK3)
   05164 Influenza A
    9451 (EIF2AK3)
   05160 Hepatitis C
    9451 (EIF2AK3)
   05168 Herpes simplex infection
    9451 (EIF2AK3)
   05169 Epstein-Barr virus infection
    9451 (EIF2AK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9451 (EIF2AK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   9451 (EIF2AK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9NZJ5(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
2p11.2
AA seq 1116 aa AA seqDB search
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccatcagcccggggctgctggtacgggcgctgctgctgctgctgctgctg
ctggggctcgcggcaaggacggtggccgcggggcgcgcccgtggcctcccagcgccgacg
gcggaggcggcgttcggcctcggggcggccgctgctcccacctcagcgacgcgagtaccg
gcggcgggcgccgtggctgcggccgaggtgactgtggaggacgctgaggcgctgccggca
gccgcgggagagcaggagcctcggggtccggaaccagacgatgagacagagttgcgaccg
cgcggcaggtcattagtaattatcagcactttagatgggagaattgctgccttggatcct
gaaaatcatggtaaaaagcagtgggatttggatgtgggatccggttccttggtgtcatcc
agccttagcaaaccagaggtatttgggaataagatgatcattccttccctggatggagcc
ctcttccagtgggaccaagaccgtgaaagcatggaaacagttcctttcacagttgaatca
cttcttgaatcttcttataaatttggagatgatgttgttttggttggaggaaaatctctg
actacatatggactcagtgcatatagtggaaaggtgaggtatatctgttcagctctgggt
tgtcgccaatgggatagtgacgaaatggaacaagaggaagacatcctgcttctacagcgt
acccaaaaaactgttagagctgtcggacctcgcagtggcaatgagaagtggaatttcagt
gttggccactttgaacttcggtatattccagacatggaaacgagagccggatttattgaa
agcacctttaagcccaatgagaacacagaagagtctaaaattatttcagatgtggaagaa
caggaagctgccataatggacatagtgataaaggtttcggttgctgactggaaagttatg
gcattcagtaagaagggaggacatctggaatgggagtaccagttttgtactccaattgca
tctgcctggttacttaaggatgggaaagtcattcccatcagtctttttgatgatacaagt
tatacatctaatgatgatgttttagaagatgaagaagacattgtagaagctgccagagga
gccacagaaaacagtgtttacttgggaatgtatagaggccagctgtatctgcagtcatca
gtcagaatttcagaaaagtttccttcaagtcccaaggctttggaatctgtcactaatgaa
aacgcaattattcctttaccaacaatcaaatggaaacccttaattcattctccttccaga
actcctgtcttggtaggatctgatgaatttgacaaatgtctcagtaatgataagttttct
catgaagaatatagtaatggtgcactttcaatcttgcagtatccatatgataatggttat
tatctaccatactacaagagggagaggaacaaacgaagcacacagattacagtcagattc
ctcgacaacccacattacaacaagaatatccgcaaaaaggatcctgttcttcttttacac
tggtggaaagaaatagttgcaacgattttgttttgtatcatagcaacaacgtttattgtg
cgcaggcttttccatcctcatcctcacaggcaaaggaaggagtctgaaactcagtgtcaa
actgaaaataaatatgattctgtaagtggtgaagccaatgacagtagctggaatgacata
aaaaactctggatatatatcacgatatctaactgattttgagccaattcaatgcctggga
cgtggtggctttggagttgtttttgaagctaaaaacaaagtagatgactgcaattatgct
atcaagaggatccgtctccccaatagggaattggctcgggaaaaggtaatgcgagaagtt
aaagccttagccaagcttgaacacccgggcattgttagatatttcaatgcctggctcgaa
gcaccaccagagaagtggcaagaaaagatggatgaaatttggctgaaagatgaaagcaca
gactggccactcagctctcctagcccaatggatgcaccatcagttaaaatacgcagaatg
gatcctttcgctacaaaagaacatattgaaatcatagctccttcaccacaaagaagcagg
tctttttcagtagggatttcctgtgaccagacaagttcatctgagagccagttctcacca
ctggaattctcaggaatggaccatgaggacatcagtgagtcagtggatgcagcatacaac
ctccaggacagttgccttacagactgtgatgtggaagatgggactatggatggcaatgat
gaggggcactcctttgaactttgtccttctgaagcttctccttatgtaaggtcaagggag
agaacctcctcttcaatagtatttgaagattctggctgtgataatgcttccagtaaagaa
gagccgaaaactaatcgattgcatattggcaaccattgtgctaataaactaactgctttc
aagcccaccagtagcaaatcttcttctgaagctacattgtctatttctcctccaagacca
accactttaagtttagatctcactaaaaacaccacagaaaaactccagcccagttcacca
aaggtgtatctttacattcaaatgcagctgtgcagaaaagaaaacctcaaagactggatg
aatggacgatgtaccatagaggagagagagaggagcgtgtgtctgcacatcttcctgcag
atcgcagaggcagtggagtttcttcacagtaaaggactgatgcacagggacctcaagcca
tccaacatattctttacaatggatgatgtggtcaaggttggagactttgggttagtgact
gcaatggaccaggatgaggaagagcagacggttctgaccccaatgccagcttatgccaga
cacacaggacaagtagggaccaaactgtatatgagcccagagcagattcatggaaacagc
tattctcataaagtggacatcttttctttaggcctgattctatttgaattgctgtatcca
ttcagcactcagatggagagagtcaggaccttaactgatgtaagaaatctcaaatttcca
ccattatttactcagaaatatccttgtgagtacgtgatggttcaagacatgctctctcca
tcccccatggaacgacctgaagctataaacatcattgaaaatgctgtatttgaggacttg
gactttccaggaaaaacagtgctcagacagaggtctcgctccttgagttcatcgggaaca
aaacattcaagacagtccaacaactcccatagccctttgccaagcaattag

DBGET integrated database retrieval system