KEGG   Homo sapiens (human): 9516Help
Entry
9516              CDS       T01001                                 

Gene name
LITAF, PIG7, SIMPLE, TP53I7
Definition
lipopolysaccharide-induced TNF factor
Organism
hsa  Homo sapiens (human)
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.13
AA seq 161 aa AA seqDB search
MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttccaggaccttaccaggcggccactgggccttcctcagcaccatccgcacct
ccatcctatgaagagacagtggctgttaacagttattaccccacacctccagctcccatg
cctgggccaactacggggcttgtgacggggcctgatgggaagggcatgaatcctccttcg
tattatacccagccagcgcccatccccaataacaatccaattaccgtgcagacggtctac
gtgcagcaccccatcacctttttggaccgccctatccaaatgtgttgtccttcctgcaac
aagatgatcgtgagtcagctgtcctataacgccggtgctctgacctggctgtcctgcggg
agcctgtgcctgctggggtgcatagcgggctgctgcttcatccccttctgcgtggatgcc
ctgcaggacgtggaccattactgtcccaactgcagagctctcctgggcacctacaagcgt
ttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system