KEGG   Homo sapiens (human): 9536Help
Entry
9536              CDS       T01001                                 

Gene name
PTGES, MGST-IV, MGST1-L1, MGST1L1, MPGES, PGES, PIG12, PP102, PP1294, TP53I12, mPGES-1
Definition
prostaglandin E synthase (EC:5.3.99.3)
Orthology
K15729  
microsomal prostaglandin-E synthase 1 [EC:5.3.99.3]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Drug target
Aceclofenac: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    9536 (PTGES)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.3  prostaglandin-E synthase
     9536 (PTGES)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.3
AA seq 152 aa AA seqDB search
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCR
SDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGK
LRAPIRSVTYTLAQLPCASMALQILWEAARHL
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccacagcctggtgatgagcagcccggccctcccggccttcctgctctgcagc
acgctgctggtcatcaagatgtacgtggtggccatcatcacgggccaagtgaggctgcgg
aagaaggcctttgccaaccccgaggatgccctgagacacggaggcccccagtattgcagg
agcgaccccgacgtggaacgctgcctcagggcccaccggaacgacatggagaccatctac
cccttccttttcctgggcttcgtctactcctttctgggtcctaacccttttgtcgcctgg
atgcacttcctggtcttcctcgtgggccgtgtggcacacaccgtggcctacctggggaag
ctgcgggcacccatccgctccgtgacctacaccctggcccagctcccctgcgcctccatg
gctctgcagatcctctgggaagcggcccgccacctgtga

DBGET integrated database retrieval system