KEGG   Homo sapiens (human): 9663Help
Entry
9663              CDS       T01001                                 

Gene name
LPIN2
Definition
lipin 2 (EC:3.1.3.4)
Orthology
K15728  
phosphatidate phosphatase LPIN [EC:3.1.3.4]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Disease
H01117  
Majeed syndrome
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18p11.31
AA seq 896 aa AA seqDB search
MNYVGQLAGQVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRS
KEKVIDIEINGSAVDLHMKLGDNGEAFFVEETEEEYEKLPAYLATSPIPTEDQFFKDIDT
PLVKSGGDETPSQSSDISHVLETETIFTPSSVKKKKRRRKKYKQDSKKEEQAASAAAEDT
CDVGVSSDDDKGAQAARGSSNASLKEEECKEPLLFHSGDHYPLSDGDWSPLETTYPQTAC
PKSDSELEVKPAESLLRSESHMEWTWGGFPESTKVSKRERSDHHPRTATITPSENTHFRV
IPSEDNLISEVEKDASMEDTVCTIVKPKPRALGTQMSDPTSVAELLEPPLESTQISSMLD
ADHLPNAALAEAPSESKPAAKVDSPSKKKGVHKRSQHQGPDDIYLDDLKGLEPEVAALYF
PKSESEPGSRQWPESDTLSGSQSPQSVGSAAADSGTECLSDSAMDLPDVTLSLCGGLSEN
GEISKEKFMEHIITYHEFAENPGLIDNPNLVIRIYNRYYNWALAAPMILSLQVFQKSLPK
ATVESWVKDKMPKKSGRWWFWRKRESMTKQLPESKEGKSEAPPASDLPSSSKEPAGARPA
ENDSSSDEGSQELEESITVDPIPTEPLSHGSTTSYKKSLRLSSDQIAKLKLHDGPNDVVF
SITTQYQGTCRCAGTIYLWNWNDKIIISDIDGTITKSDALGQILPQLGKDWTHQGIAKLY
HSINENGYKFLYCSARAIGMADMTRGYLHWVNDKGTILPRGPLMLSPSSLFSAFHREVIE
KKPEKFKIECLNDIKNLFAPSKQPFYAAFGNRPNDVYAYTQVGVPDCRIFTVNPKGELIQ
ERTKGNKSSYHRLSELVEHVFPLLSKEQNSAFPCPEFSSFCYWRDPIPEVDLDDLS
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgtgggacagctggctgggcaggtgattgtcactgtgaaggaactctacaag
ggcattaaccaggccaccctctctgggtgcattgatgtcatcgtggtacagcagcaggat
ggcagctatcagtgttcaccttttcacgttcggtttggaaagctgggagtcctgagatcc
aaagagaaagtgattgatatagaaatcaacggcagtgcagtggatcttcacatgaagttg
ggtgataacggagaagctttctttgttgaggagactgaagaagaatatgaaaagcttcct
gcttaccttgccacctcaccaattcctactgaagatcagttctttaaagatattgacacc
cctttggtgaaatcgggtggagatgaaacaccatctcagagttcagacatctcacacgtc
ttggaaacagagacaatttttactccaagttctgtgaaaaagaaaaaacgaaggagaaag
aaatacaaacaggacagtaagaaggaagagcaggccgcatctgctgctgcagaagacaca
tgtgatgtaggcgtgagctccgatgatgacaagggggcccaggcagcacgaggatcttca
aatgcttccttgaaagaagaagaatgtaaagagcctttgctcttccattctggggatcat
taccccttatctgatggagattggtcccctttagagaccacctatccccagacagcgtgt
cctaagagtgattcagagctggaggtgaaacctgcggagagcctgctcagatcagagtct
cacatggagtggacgtggggcggattcccagagtccaccaaggtcagcaaaagagaacga
tctgaccatcatcctaggacagctacaattacaccatcagaaaatactcattttcgggta
attcccagtgaggacaacctcatcagtgaagttgagaaggatgcttccatggaagacact
gtctgtaccatagtgaagcccaaacccagagccctgggtacacagatgagcgacccaaca
tctgtggcagagcttctcgaacctcctcttgagagtactcagatttcatctatgttagat
gctgaccaccttcccaacgcagccttagcggaggcgccctcagaatccaaaccggcagct
aaagtagactcgccgtcaaagaagaaaggtgttcacaaaagaagccaacaccagggacct
gatgatatttaccttgatgacttaaagggtctagaacctgaagttgcagctctttatttc
cctaaaagtgaatcggagcccggttccaggcagtggcccgagtctgacacactctctggc
tcccagtccccacagtccgtgggaagcgcagctgcagatagcggcaccgagtgcctctca
gattctgccatggacttgcctgacgttaccctctccctttgcgggggcctcagtgaaaat
ggagaaatttcaaaagaaaaattcatggagcatatcattacttatcacgaatttgcagaa
aaccctggacttatagacaatcctaaccttgtaataaggatatataatcgttactataac
tgggctttggcagctcccatgatccttagcttgcaagtattccagaagagcttgcctaag
gccacagttgagtcctgggtgaaagacaagatgccaaagaaatctggtcgctggtggttt
tggcgaaagagagaaagcatgaccaaacagctgccagaatccaaggagggaaaatctgag
gcaccgccagccagtgacctgccatccagctccaaggagccggccggtgccaggccggcc
gagaatgactcctcgagtgacgagggatcacaggagctcgaagaatccatcacagtggac
cccatccccacagagcccctgagccacggcagcacaacttcatataagaagtctctccgc
ctctcctcagaccagatcgcaaaactgaagctccacgatggcccaaatgatgttgtgttt
agtattacaacccagtatcaaggcacctgtcgctgtgcagggaccatttacctgtggaac
tggaatgacaagatcatcatttctgatattgatgggacaataaccaagtcggatgctttg
ggacagattctcccacagctgggcaaagactggacccaccagggtatagcaaagctctac
cattccatcaatgagaatggctacaagtttctgtactgctcggctcgtgccatcggcatg
gccgacatgacccgtggctacctgcactgggtcaatgacaagggcacaatcttgccccgg
ggccccctgatgctgtcccccagcagcttgttctccgccttccacagagaagtgatagaa
aagaaaccagagaagttcaaaattgagtgtctaaatgatatcaagaatctgtttgccccg
tctaagcagcccttctatgctgcctttggaaaccgtccaaatgatgtctatgcctacaca
caagttggagttccagactgtagaatattcaccgtgaaccccaagggtgaattaatacaa
gaaagaaccaaaggaaacaagtcatcgtatcacaggctgagtgagctcgtggagcatgtg
ttcccccttctcagtaaggagcagaattccgcttttccctgcccggagttcagctccttc
tgctactggcgagacccgatccctgaagtggacctggatgacctgtcttga

DBGET integrated database retrieval system