KEGG   Homo sapiens (human): 53947Help
Entry
53947             CDS       T01001                                 

Gene name
A4GALT, A14GALT, A4GALT1, Gb3S, P(k), P1, P1PK, PK
Definition
alpha 1,4-galactosyltransferase (EC:2.4.1.228)
Orthology
K01988  
lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, globo-series, LacCer => Gb4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    53947 (A4GALT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     53947 (A4GALT)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  P blood group
   53947 (A4GALT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.2
AA seq 353 aa AA seqDB search
MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIP
CPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGG
NASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRI
ALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDH
YNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDIN
PEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccccccgacctcctgctgcggctgctccggggcgccccaaggcagcgggtc
tgcaccctgttcatcatcggcttcaagttcacgtttttcgtctccatcatgatctactgg
cacgttgtgggagagcccaaggagaaagggcagctctataacctgccagcagagatcccc
tgccccaccttgacaccccccaccccaccctcccacggccccactccaggcaacatcttc
ttcctggagacttcagaccggaccaaccccaacttcctgttcatgtgctcggtggagtcg
gccgccagaactcaccccgaatcccacgtgctggtcctgatgaaagggcttccgggtggc
aacgcctctctgccccggcacctgggcatctcacttctgagctgcttcccgaatgtccag
atgctcccgctggacctgcgggagctgttccgggacacacccctggccgactggtacgcg
gccgtgcaggggcgctgggagccctacctgctgcccgtgctctccgacgcctccaggatc
gcactcatgtggaagttcggcggcatctacctggacacggacttcattgttctcaagaac
ctgcggaacctgaccaacgtgctgggcacccagtcccgctacgtcctcaacggcgcgttc
ctggccttcgagcgccggcacgagttcatggcgctgtgcatgcgggacttcgtggaccac
tacaacggctggatctggggtcaccagggcccgcagctgctcacgcgggtcttcaagaag
tggtgttccatccgcagcctggccgagagccgcgcctgccgcggcgtcaccaccctgccc
cctgaggccttctaccccatcccctggcaggactggaagaagtactttgaggacatcaac
cccgaggagctgccgcggctgctcagtgccacctatgctgtccacgtgtggaacaagaag
agccagggcacgcggttcgaggccacgtccagggcactgctggcccagctgcatgcccgc
tactgccccacgacgcacgaggccatgaaaatgtacttgtga

DBGET integrated database retrieval system