KEGG   Homo sapiens (human): 51146Help
Entry
51146             CDS       T01001                                 

Gene name
A4GNT, alpha4GnT
Definition
alpha-1,4-N-acetylglucosaminyltransferase
Orthology
K08251  
alpha 1,4-N-acetylglucosaminyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p14.3
AA seq 340 aa AA seqDB search
MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSER
MEPPHLVSCSVESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLD
MKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEEN
FLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSAIWGNQGPELMTRMLRVWCKLED
FQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
IRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaggagctccagctctccctgtcagtcaccttgctgcttgtctgtggcttcctc
taccagttcaccctgaagtccagctgcctcttctgtttgccttctttcaagtcccaccag
gggctggaagccctcctgagccacagacgtggcattgtgtttctagagacctcagagaga
atggagccaccccatttggtctcctgttccgtagagtctgctgccaagatttatcctgag
tggcctgtggtgttctttatgaagggtcttactgattccacaccgatgccctcaaactcc
acatacccagctttttccttcctgtcagcaatagacaacgttttcctcttccctttggat
atgaaaaggctgcttgaagacacaccattgttttcatggtacaatcaaatcaacgccagc
gcagagagaaactggctccacatcagctcggatgcatcccgcctggccatcatctggaaa
tacggtggcatctacatggacaccgatgtcatctccatcaggcccatccctgaggagaac
tttttggctgcgcaggcttctcggtactctagtaatggaatatttgggttcctcccccac
cacccctttttgtgggaatgcatggaaaactttgttgaacactataattcagccatttgg
ggcaaccaaggccctgagttgatgacaaggatgttgagggtatggtgtaaacttgaagac
ttccaggaggtgagcgacctcaggtgtctgaacatatccttcttacacccccaaagattt
taccccatctcctatcgagagtggaggcgctactatgaagtgtgggatacagagccaagc
ttcaatgtctcttatgccctgcatttgtggaaccacatgaaccaggaggggcgggctgtg
attagaggaagcaacacactggtggaaaatctctatcgcaagcactgtcccaggacttac
agggacctgattaaaggcccagaggggtcagtgactggggagctgggtccaggtaacaaa
taa

DBGET integrated database retrieval system