KEGG   Homo sapiens (human): 79868Help
Entry
79868             CDS       T01001                                 

Gene name
ALG13, CDG1S, CXorf45, GLT28D1, MDS031, TDRD13, YGL047W
Definition
ALG13, UDP-N-acetylglucosaminyltransferase subunit (EC:3.4.19.12 2.4.1.141)
Orthology
K07432  
beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    79868 (ALG13)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     79868 (ALG13)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   79868 (ALG13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq23
AA seq 138 aa AA seqDB search
MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDV
YRCRKLFGDSGKRKATRSGYKRKVDEQSSAGTGKAATQRGSSLLLYLQHASWAVTVNGLI
NTEMLSSWPARKIFCIFG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcgtgtttgttaccgtagggaccaccagctttgacgacctcattgcgtgtgtg
tcggcgcccgacagtctgcaaaaaatcgagagccttggttacaaccgacttatcctgcaa
attggtagaggaacggtggtacctgaacccttcagtactgagtcgtttactctggatgtt
tacaggtgcaggaagctgtttggagactctggaaaaaggaaagccactcgtagtggttat
aaacgaaaagttgatgaacaatcatcagctggaactggcaaagcagctacacaaagaggg
tcatctcttctattgtacctgcagcacgcttcctgggctgttacagtcaatggacttatc
aacactgaaatgttatcctcctggccagccagaaaaattttctgcatttttggataa

DBGET integrated database retrieval system