KEGG   Homo sapiens (human): 199857Help
Entry
199857            CDS       T01001                                 

Gene name
ALG14
Definition
ALG14, UDP-N-acetylglucosaminyltransferase subunit
Orthology
K07441  
beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p21.3
AA seq 216 aa AA seqDB search
MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLS
NAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVF
TTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVET
LSMSGKILFHLSDYFIVQWPALKEKYPKSVYLGRIV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcgttctcgttctagctgcggccgcaggagctgtggcggttttcctaatcctg
cgaatatgggtagtgcttcgttccatggacgttacgccccgggagtctctcagtatcttg
gtagtggctgggtccggtgggcataccactgagatcctgaggctgcttgggagcttgtcc
aatgcctactcacctagacattatgtcattgctgacactgatgaaatgagtgccaataaa
ataaattcttttgaactagatcgagctgatagagaccctagtaacatgtataccaaatac
tacattcaccgaattccaagaagccgggaggttcagcagtcctggccctccaccgttttc
accaccttgcactccatgtggctctcctttcccctaattcacagggtgaagccagatttg
gtgttgtgtaacggaccaggaacatgtgttcctatctgtgtatctgcccttctccttggg
atactaggaataaagaaagtgatcattgtctacgttgaaagcatctgccgtgtagaaacg
ttatccatgtccggaaagattctgtttcatctctcagattacttcattgttcagtggccg
gctctgaaagaaaagtatcccaaatcggtgtaccttgggcgaattgtttga

DBGET integrated database retrieval system