KEGG   Homo sapiens (human): 199857Help
Entry
199857            CDS       T01001                                 

Gene name
ALG14
Definition
ALG14, UDP-N-acetylglucosaminyltransferase subunit
Orthology
K07441  
beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    199857 (ALG14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     199857 (ALG14)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   199857 (ALG14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p21.3
AA seq 216 aa AA seqDB search
MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLS
NAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVF
TTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVET
LSMSGKILFHLSDYFIVQWPALKEKYPKSVYLGRIV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgcgttctcgttctagctgcggccgcaggagctgtggcggttttcctaatcctg
cgaatatgggtagtgcttcgttccatggacgttacgccccgggagtctctcagtatcttg
gtagtggctgggtccggtgggcataccactgagatcctgaggctgcttgggagcttgtcc
aatgcctactcacctagacattatgtcattgctgacactgatgaaatgagtgccaataaa
ataaattcttttgaactagatcgagctgatagagaccctagtaacatgtataccaaatac
tacattcaccgaattccaagaagccgggaggttcagcagtcctggccctccaccgttttc
accaccttgcactccatgtggctctcctttcccctaattcacagggtgaagccagatttg
gtgttgtgtaacggaccaggaacatgtgttcctatctgtgtatctgcccttctccttggg
atactaggaataaagaaagtgatcattgtctacgttgaaagcatctgccgtgtagaaacg
ttatccatgtccggaaagattctgtttcatctctcagattacttcattgttcagtggccg
gctctgaaagaaaagtatcccaaatcggtgtaccttgggcgaattgtttga

DBGET integrated database retrieval system