KEGG   Homo sapiens (human): 85365Help
Entry
85365             CDS       T01001                                 

Gene name
ALG2, CDGIi, NET38, hALPG2
Definition
ALG2, alpha-1,3/1,6-mannosyltransferase (EC:2.4.1.132 2.4.1.257)
Orthology
K03843  
alpha-1,3/alpha-1,6-mannosyltransferase [EC:2.4.1.132 2.4.1.257]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
9q22.33
AA seq 416 aa AA seqDB search
MAEEQGRERDSVPKPSVLFLHPDLGVGGAERLVLDAALALQARGCSVKIWTAHYDPGHCF
AESRELPVRCAGDWLPRGLGWGGRGAAVCAYVRMVFLALYVLFLADEEFDVVVCDQVSAC
IPVFRLARRRKKILFYCHFPDLLLTKRDSFLKRLYRAPIDWIEEYTTGMADCILVNSQFT
AAVFKETFKSLSHIDPDVLYPSLNVTSFDSVVPEKLDDLVPKGKKFLLLSINRYERKKNL
TLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFL
RSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQCPVIAVNSGGPLESIDHSVTGF
LCEPDPVHFSEAIEKFIREPSLKATMGLAGRARVKEKFSPEAFTEQLYRYVTKLLV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggagcagggccgggaacgggactcggttcccaagccgtcggtgctgttcctc
cacccagacctgggcgtgggcggcgctgagcggctggtgttggacgcggcgctggcgctg
caggcgcgcgggtgtagcgtgaagatctggacagcgcactacgacccgggccactgtttc
gccgagagccgcgagctaccggtgcgctgtgccggggactggctgccgcgaggcctgggc
tggggcggccgcggcgccgccgtctgcgcctacgtgcgcatggttttcctggcgctctac
gtgctgttcctcgccgacgaggagttcgacgtggtagtgtgcgaccaggtgtctgcctgt
atcccagtgttcaggctggctagacggcggaagaagatcctattttactgtcacttccca
gatctgcttctcaccaagagagattcttttcttaaacgactatacagggccccaattgac
tggatagaggaatacaccacaggcatggcagactgcatcttagtcaacagccagttcaca
gctgctgtttttaaggaaacattcaagtccctgtctcacatagaccctgatgtcctctat
ccatctctaaatgtcaccagctttgactcagttgttcctgaaaagctggatgacctagtc
cccaaggggaaaaaattcctgctgctctccatcaacagatacgaaaggaagaaaaatctg
actttggcactggaagccctagtacagctgcgtggaagattgacatcccaagattgggag
agggttcatctgatcgtggcaggtggttatgacgagagagtcctggagaatgtggaacat
tatcaggaattgaagaaaatggtccaacagtccgaccttggccagtatgtgaccttcttg
aggtctttctcagacaaacagaaaatctccctcctccacagctgcacgtgtgtgctttac
acaccaagcaatgagcactttggcattgtccctctggaagccatgtacatgcagtgccca
gtcattgctgttaattcgggtggacccttggagtccattgaccacagtgtcacagggttt
ctgtgtgagcctgacccggtgcacttctcagaagcaatagaaaagttcatccgtgaacct
tccttaaaagccaccatgggcctggctggaagagccagagtgaaggaaaaattttcccct
gaagcatttacagaacagctctaccgatatgttaccaaactgctggtataa

DBGET integrated database retrieval system