KEGG   Homo sapiens (human): 29880Help
Entry
29880             CDS       T01001                                 

Gene name
ALG5, bA421P11.2
Definition
ALG5, dolichyl-phosphate beta-glucosyltransferase (EC:2.4.1.117)
Orthology
K00729  
dolichyl-phosphate beta-glucosyltransferase [EC:2.4.1.117]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    29880 (ALG5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.117  dolichyl-phosphate beta-glucosyltransferase
     29880 (ALG5)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   29880 (ALG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
13q13.3
AA seq 294 aa AA seqDB search
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIW
DSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKYGSDKVRVITLVKNRGKGGAIRMG
IFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSY
FRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQF
FKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcttctgttgcagctggcggtgctcggcgcggcgctggcggccgcagccctc
gtactgatttccatcgttgcatttacaactgctacaaaaatgccagcactccatcgacat
gaagaagagaaattcttcttaaatgccaaaggccagaaagaaactttacccagcatatgg
gactcacctaccaaacaactttctgtcgttgtgccttcatacaatgaagaaaaacggttg
cctgtgatgatggatgaagctctgagctatctagagaagagacagaaatatggaagtgac
aaagtacgtgtgataaccctggtgaagaatcgtggaaaaggtggagcgattagaatgggt
atattcagttctcgaggagaaaagatccttatggcagatgctgatggagccacaaagttt
ccagatgttgagaaattagaaaaggggctaaatgatctacagccttggcctaatcaaatg
gctatagcatgtggatctcgagctcatttagaaaaagaatcaattgctcagcgttcttac
ttccgtactcttctcatgtatgggttccactttctggtgtggttcctttgtgtcaaagga
atcagggacacacagtgtgggttcaaattatttactcgagaagcagcttcacggacgttt
tcatctctacacgttgaacgatgggcatttgatgtagaactactgtacatagcacagttc
tttaaaattccaatagcagaaattgctgtcaactggacagaaattgaaggttctaaatta
gttccattctggagctggctacaaatgggtaaagacctactttttatacgacttcgatat
ttgactggtgcctggaggcttgagcaaactcggaaaatgaattag

DBGET integrated database retrieval system