KEGG   Homo sapiens (human): 29929Help
Entry
29929             CDS       T01001                                 

Gene name
ALG6, CDG1C
Definition
(RefSeq) ALG6, alpha-1,3-glucosyltransferase
  KO
K03848  alpha-1,3-glucosyltransferase [EC:2.4.1.267]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00055  N-glycan precursor biosynthesis
Disease
H00118  Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    29929 (ALG6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.267  dolichyl-P-Glc:Man9GlcNAc2-PP-dolichol alpha-1,3-glucosyltransferase
     29929 (ALG6)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   29929 (ALG6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alg6_Alg8 7tm_1
Motif
Other DBs
NCBI-GeneID: 29929
NCBI-ProteinID: NP_037471
OMIM: 604566
HGNC: 23157
Ensembl: ENSG00000088035
Vega: OTTHUMG00000009140
Pharos: Q9Y672(Tdark)
UniProt: Q9Y672
Position
1p31.3
AA seq 507 aa AA seqDB search
MEKWYLMTVVVLIGLTVRWTVSLNSYSGAGKPPMFGDYEAQRHWQEITFNLPVKQWYFNS
SDNNLQYWGLDYPPLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIAD
LLIYIPAVVLYCCCLKEISTKKKIANALCILLYPGLILIDYGHFQYNSVSLGFALWGVLG
ISCDCDLLGSLAFCLAINYKQMELYHALPFFCFLLGKCFKKGLKGKGFVLLVKLACIVVA
SFVLCWLPFFTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDILPRHIQLIM
SFCSTFLSLLPACIKLILQPSSKGFKFTLVSCALSFFLFSFQVHEKSILLVSLPVCLVLS
EIPFMSTWFLLVSTFSMLPLLLKDELLMPSVVTTMAFFIACVTSFSIFEKTSEEELQLKS
FSISVRKYLPCFTFLSRIIQYLFLISVITMVLLTLMTVTLDPPQKLPDLFSVLVCFVSCL
NFLFFLVYFNIIIMWDSKSGRNQKKIS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatggtacttgatgacagtagtggttttaataggactaacagtacgatggaca
gtgtctcttaattcttattcaggtgctggtaaaccgcctatgtttggtgattatgaagct
cagagacactggcaagaaataacttttaatttaccggtcaaacaatggtattttaacagc
agtgataacaatttacagtattggggattggattacccacctcttacagcttatcatagt
ctcctatgtgcatatgtggcaaagtttataaatccagactggattgctctccatacatca
cgtggatatgagagtcaggcacataagctcttcatgcgtacaacagttttaattgctgat
ctgctgatttacatacctgcagtggttttgtactgttgttgcttaaaagaaatctcaact
aagaaaaagattgctaatgcattatgcatcttgctgtatccaggccttattcttatagac
tatggacattttcaatataattctgtgagtcttggctttgctttgtggggtgttcttgga
atatcttgtgactgcgacctcctagggtcactggcattttgcttagctataaattataaa
cagatggaactttaccacgccttgccatttttttgctttttacttggcaagtgttttaaa
aaaggcctcaaaggaaaggggtttgtgttgctagttaagctagcttgtattgttgtggct
tccttcgttctctgctggctgccattctttacagaaagggaacaaaccctgcaggttcta
agaagactcttcccggttgatcgtggattatttgaggataaagtagccaatatttggtgc
agcttcaatgtctttctgaagattaaggatattttgccacgtcacatccaattaataatg
agcttttgttctacgtttttgagcctgcttcctgcatgcataaaattaatacttcagccc
tcttccaaaggattcaaatttacactggttagctgtgcgctatcattctttttattttct
ttccaagtacatgaaaaatccattctcttggtgtcactaccagtctgcttagttttaagt
gaaattccttttatgtctacttggtttttacttgtgtcaacatttagtatgctacctctt
ctattgaaggatgaactcctaatgccctctgttgtgacaacaatggcattttttatagct
tgtgtaacttccttttcaatatttgaaaagacttctgaagaagaactgcagttgaaatcc
ttttccatttctgtgaggaaatatcttccatgttttacatttctttccagaattatacaa
tatttgtttcttatctcagtcatcactatggtgcttctgacgttgatgactgtcacactg
gatcctcctcagaaactaccggacttgttttctgtattggtgtgttttgtatcttgcttg
aacttcctgttcttcttggtatactttaacattattattatgtgggattccaaaagtgga
agaaatcagaagaaaatcagctag

DBGET integrated database retrieval system