KEGG   Homo sapiens (human): 79053Help
Entry
79053             CDS       T01001                                 

Gene name
ALG8, CDG1H
Definition
ALG8, alpha-1,3-glucosyltransferase (EC:2.4.1.265)
Orthology
K03849  
alpha-1,3-glucosyltransferase [EC:2.4.1.265]
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Metabolic pathways
Module
N-glycan precursor biosynthesis
Disease
H00118  
Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    79053 (ALG8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.265  dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichol alpha-1,3-glucosyltransferase
     79053 (ALG8)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   79053 (ALG8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q14.1
AA seq 467 aa AA seqDB search
MAALTIATGTGNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEAT
SEWTLDYPPFFAWFEYILSHVAKYFDQEMLNVHNLNYSSSRTLLFQRFSVIFMDVLFVYA
VRECCKCIDGKKVGKELTEKPKFILSVLLLWNFGLLIVDHIHFQYNGFLFGLMLLSIARL
FQKRHMEGAFLFAVLLHFKHIYLYVAPAYGVYLLRSYCFTANKPDGSIRWKSFSFVRVIS
LGLVVFLVSALSLGPFLALNQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIG
LKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTPLATLICTLIAILPSIFCLWFKPQGPR
GFLRCLTLCALSSFMFGWHVHEKAILLAILPMSLLSVGKAGDASIFLILTTTGHYSLFPL
LFTAPELPIKILLMLLFTIYSISSLKTLFRRSFTLVAQAGVQWHDLS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcacaattgccacgggtactggcaattggttttcggctttggcgctcggg
gtgactcttctcaaatgccttctcatccccacataccattccacagattttgaagtacac
cgaaactggcttgctatcactcacagtttgccaatatcacagtggtattatgaggcaact
tcagagtggacgttggattacccccctttctttgcatggtttgagtatatcctgtcacat
gttgccaaatattttgatcaagaaatgctgaatgtccataatttgaattactccagctca
aggaccttacttttccagagattttccgtcatctttatggatgtactctttgtgtatgct
gtccgtgagtgctgtaaatgcattgatggaaaaaaagtgggtaaagaacttacagaaaag
ccaaaatttattctgtcggtattacttctgtggaacttcgggttattaattgtggaccat
attcattttcagtacaatggctttttatttggattaatgctactctccattgcacgatta
tttcagaaaaggcatatggaaggagcatttctctttgctgttctcctacatttcaagcat
atctacctctatgtagcaccagcttatggtgtatatctgctgcgatcctactgtttcact
gcaaataaaccagatgggtctattcgatggaagagtttcagctttgttcgtgttatttcc
ctgggactggttgttttcttagtttctgctctttcattgggtcctttcctggccttgaat
cagctgcctcaagtcttttcccgactctttcctttcaagaggggcctctgtcatgcatat
tgggctccaaacttctgggctttgtacaatgctttggacaaagtgctgtctgtcatcggt
ttgaaattgaaatttcttgatcccaacaatattcccaaggcctcaatgacaagtggtttg
gttcagcagttccaacacacagtccttccctcagtgactcccttggcaaccctcatctgc
acactgattgccatattgccctctattttctgtctttggtttaaaccccaagggcccaga
ggctttctccgatgtctaactctttgtgccttgagctcctttatgtttgggtggcatgtt
catgaaaaagccatacttctagcaattctcccaatgagccttttgtctgtgggaaaagca
ggagacgcttcgatttttctgattctgaccacaacaggacattattccctctttcctctg
ctcttcactgcaccagaacttcccattaaaatcttactcatgttactattcaccatatat
agtatttcgtcactgaagactttattcagacggagtttcacccttgttgcccaggctgga
gtgcaatggcacgatctcagctaa

DBGET integrated database retrieval system