KEGG   Homo sapiens (human): 8707Help
Entry
8707              CDS       T01001                                 

Gene name
B3GALT2, BETA3GALT2, GLCT2, beta3Gal-T2
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
Orthology
K07820  
beta-1,3-galactosyltransferase 2 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    8707 (B3GALT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     8707 (B3GALT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 1 chain
   8707 (B3GALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31
AA seq 422 aa AA seqDB search
MLQWRRRHCCFAKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPV
TYTFRGFRSTKSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVTGLENTLSANG
SIYNEKGTGHPNSYHFKYIINEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLA
PGIQITRIFLLGLSIKLNGYLQRAILEESRQYHDIIQQEYLDTYYNLTIKTLMGMNWVAT
YCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTGYLMRGYAPNRNKDSKWYMPP
DLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPN
EFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK
LH
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagtggaggagaagacactgctgctttgcaaagatgacctggaatgccaaaagg
tctctgttccgcactcatcttattggagtactttctctagtgtttctttttgctatgttt
ttgtttttcaatcatcatgactggctgccaggcagagctggattcaaagaaaaccctgtg
acatacactttccgaggatttcggtcaacaaaaagtgagacaaaccacagctcccttcgg
aacatttggaaagaaacagtccctcaaaccctgaggcctcaaacagcaactaactctaat
aacacagacctgtcaccacaaggagttacaggcctggagaatacacttagtgccaatgga
agtatttacaatgaaaaaggtactggacatccaaattcttaccatttcaaatatattatt
aatgagcctgaaaaatgccaagagaaaagtccttttttaatactactaatagctgcagag
cctggacaaatagaagctagaagagctattcggcaaacttggggcaatgaaagtctagca
cctggtattcaaatcacaagaatatttttgttgggcttaagtattaagctaaatggctac
cttcaacgtgcaatactggaagaaagcagacaatatcatgatataattcaacaggaatac
ttagatacgtactataatttgaccattaaaacactaatgggcatgaactgggttgcaaca
tactgtccacatattccatatgttatgaaaactgacagtgacatgtttgtcaacactgaa
tatttaatcaataagttactgaagccagatctgcctcccagacataactatttcactggt
tacctaatgcgaggatatgcacccaatcgaaacaaagatagcaagtggtacatgccacca
gacctctacccaagtgagcgttatcctgtcttctgttctggaactggttatgttttttct
ggagatctggcagaaaagatttttaaagtttctttaggtatccgccgtttgcacttggaa
gatgtatatgtagggatctgtcttgccaagttgagaattgatcctgtaccccctcccaat
gagtttgtgttcaatcactggcgagtctcttattcgagctgtaaatacagccacctaatt
acctctcatcagttccagcctagtgaactgataaaatactggaaccatttacaacaaaat
aagcacaatgcctgtgccaacgcagcaaaagaaaaggcaggcaggtatcgccaccgtaaa
ctacattag

DBGET integrated database retrieval system