KEGG   Homo sapiens (human): 8705Help
Entry
8705              CDS       T01001                                 

Gene name
B3GALT4, BETA3GALT4, GALT2, GALT4
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 (EC:2.4.1.62)
Orthology
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    8705 (B3GALT4)
   00604 Glycosphingolipid biosynthesis - ganglio series
    8705 (B3GALT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     8705 (B3GALT4)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Glycolipid
   8705 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 378 aa AA seqDB search
MQLRLFRRLLLAALLLVIVWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLIPN
QEACSGPGAPPFLLILVCTAPENLNQRNAIRASWGGLREARGLRVQTLFLLGEPNAQHPV
WGSQGSDLASESAAQGDILQAAFQDSYRNLTLKTLSGLNWAEKHCPMARYVLKTDDDVYV
NVPELVSELVLRGGRWGQWERSTEPQREAEQEGGQVLHSEEVPLLYLGRVHWRVNPSRTP
GGRHRVSEEQWPHTWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGVSARR
GGLAPTQCVKLAGATHYPLDRCCYGKFLLTSHRLDPWKMQEAWKLVGGSDGERTAPFCSW
FQGVLGILRCRAIAWLQS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaggctcttccggcgcctccttctcgccgctttgctgctggtgatcgtctgg
accctcttcgggccttcggggttgggggaggagctgctgagcctctcactagcctccctg
ctcccagcccccgcctcaccggggccgcccctggccctgccccgcctcttgatccccaac
caggaagcttgcagtggtcccggggcccctcccttcctgctcatcctggtgtgcacggct
ccggagaacctgaaccagagaaacgccattcgggcttcgtggggcgggctgcgcgaggcc
cgggggctcagggtacagacgctattcttgctgggagagccgaacgcacagcaccccgtg
tggggttcccaggggagtgacctggcctcggagtcagcagcccagggggatatcttgcag
gccgccttccaggactcctaccgcaacctcaccctaaagaccctcagcgggctgaactgg
gctgagaaacactgccccatggcccgatacgtcctcaagacggacgatgatgtgtatgtc
aacgtccctgaactggtatcagagctggtcttgcgagggggccgttgggggcaatgggag
agaagcacggaaccccagagagaggctgagcaggaaggaggccaggttttgcacagcgag
gaagtgcctcttctgtacttgggccgggtgcactggcgcgtgaacccctctcggacaccg
gggggcaggcaccgcgtatcagaggagcagtggcctcacacctggggcccctttccaccc
tatgcctcaggcacggggtatgtgctgtcagcgtctgctgtgcagctcattctcaaggtg
gccagccgggcaccccttctcccattagaggatgtctttgtgggggtaagtgcccgacga
ggaggcctcgccccaacacagtgtgtcaagctggctggtgccacccactacccgctagac
cggtgctgctatgggaaattcctgctgacgtcccacaggctggacccctggaagatgcag
gaagcctggaagctggtgggtggctctgacggggaaaggactgcgcccttttgctcctgg
ttccagggagtcctgggcatcctgcggtgtcgagcaatagcctggcttcagagctga

DBGET integrated database retrieval system