KEGG   Homo sapiens (human): 10317Help
Entry
10317             CDS       T01001                                 

Gene name
B3GALT5, B3GalT-V, B3GalTx, B3T5, GLCT5, beta-1,3-GalTase_5, beta-3-Gx-T5, beta3Gal-T5
Definition
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Orthology
K03877  
beta-1,3-galactosyltransferase 5 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    10317 (B3GALT5)
   00603 Glycosphingolipid biosynthesis - globo series
    10317 (B3GALT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     10317 (B3GALT5)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 1 chain
   10317 (B3GALT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 310 aa AA seqDB search
MAFPKMRLMYICLLVLGALCLYFSMYSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLV
LLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDII
QKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFF
TGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIK
LEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALE
NSRGEDCPPV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggctttcccgaagatgagattgatgtatatttgccttctggttctgggggctctttgt
ttgtattttagcatgtacagtctaaatcctttcaaagaacagtcctttgtttacaagaaa
gacgggaacttccttaagctcccagatacagactgcaggcagacacctcccttcctcgtc
ctgctggtgacctcatcccacaaacagttggctgagcgcatggccatccggcagacgtgg
gggaaagagaggatggtgaagggaaagcagctgaagacattcttcctcctggggaccacc
agcagtgcagcggaaacgaaagaggtggaccaggagagccagcgacacggggacattatc
cagaaggatttcctagacgtctattacaatctgaccctgaagaccatgatgggcatagaa
tgggtccatcgcttttgtcctcaggcggcgtttgtgatgaaaacagactcagacatgttc
atcaatgttgactatctgactgaactgcttctgaagaaaaacagaacaaccaggtttttc
actggcttcttgaaactcaatgagtttcccatcaggcagccattcagcaagtggtttgtc
agtaaatctgaatatccgtgggacaggtacccaccattctgctccggcaccggctacgtg
ttttctggcgacgtggcgagtcaggtgtacaatgtctccaagagcgtcccatacattaaa
ctggaagacgtgtttgtggggctctgcctcgaaaggctgaacatcagattggaggagctc
cactcccagccgaccttttttccagggggcttacgcttctccgtatgcctcttcaggagg
atcgtggcctgccacttcatcaagcctcggactctcttggactactggcaggctctagag
aattcccggggggaagattgtccgcctgtctga

DBGET integrated database retrieval system