KEGG   Homo sapiens (human): 126792Help
Entry
126792            CDS       T01001                                 

Gene name
B3GALT6, EDSP2, SEMDJL1, beta3GalT6
Definition
UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 (EC:2.4.1.134)
Orthology
K00734  
galactosylxylosylprotein 3-beta-galactosyltransferase [EC:2.4.1.134]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate [PATH:hsa00532]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - heparan sulfate / heparin [PATH:hsa00534]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.33
AA seq 329 aa AA seqDB search
MKLLRRAWRRRAALGLGTLALCGAALLYLARCAAEPGDPRAMSGRSPPPPAPARAAAFLA
VLVASAPRAAERRSVIRSTWLARRGAPGDVWARFAVGTAGLGAEERRALEREQARHGDLL
LLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDSFARLDALLAELRAREPARRRR
LYWGFFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVHYLRLSRDYLRAWHS
EDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLC
KREVQLRLSYVYDWSAPPSQCCQRREGIP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgctgcggcgggcgtggcggcggcgggcggcgctaggcctgggcacgctggcg
ctgtgcggggcggcgctgctctacctggcgcgctgcgcggccgagcccggggaccccagg
gcgatgtcgggccgcagcccgcctccccccgcgcccgcgcgcgccgccgccttcctggca
gtgctggtggccagcgcgccccgcgccgccgagcgccgcagcgtgatccgcagcacgtgg
cttgcgcggcgcggggccccgggcgacgtgtgggcgcgctttgccgtgggcacggccggc
ctgggcgccgaggagcggcgcgccctggagcgggagcaggcgcggcacggggacctgctg
ctgctgcccgcgctgcgcgacgcctacgaaaacctcacggccaaggtgctggccatgctg
gcctggctggacgagcacgtggccttcgagttcgtgctcaaggcggacgacgactccttc
gcgcggctggacgcgctgctggccgagctgcgcgcccgcgagcccgcgcgccgccgccgc
ctctactggggcttcttctcgggccgcggccgcgtcaagccgggggggcgctggcgcgag
gccgcctggcaactctgcgactactacctgccctacgcgctgggcggcggctacgtgctc
tcggccgacctggtgcactacctgcgcctcagccgcgactacctgcgcgcctggcacagc
gaggacgtgtctctgggcgcctggctggcgccggtggacgtccagcgggagcacgacccg
cgcttcgacaccgaataccggtcccgcggctgcagcaaccagtacctggtgacgcacaag
cagagcctggaggacatgctggagaagcacgcgacgctggcgcgcgagggccgcctgtgc
aagcgcgaggtgcagctgcgcctgtcctacgtgtacgactggtccgcgccgccctcgcag
tgctgccagagaagggagggcatcccctga

DBGET integrated database retrieval system