KEGG   Homo sapiens (human): 135152Help
Entry
135152            CDS       T01001                                 

Gene name
B3GAT2, GLCATS
Definition
beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S) (EC:2.4.1.135)
Orthology
K10157  
galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 [EC:2.4.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:hsa00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q13
AA seq 323 aa AA seqDB search
MKSALFTRFFILLPWILIVIIMLDVDTRRPVPPLTPRPYFSPYAVGRGGARLPLRRGGPA
HGTQKRNQSRPQPQPEPQLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAA
ARSELVSRFLARAGLPSTHLHVPTPRRYKRPGLPRATEQRNAGLAWLRQRHQHQRAQPGV
LFFADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPF
AIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWH
TRTEKVNLANEPKYHLDTVKIEV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgcgcttttcacccgcttctttatcctcctgccctggatcctaattgtcatc
atcatgctcgacgtggacacgcgcaggccagtgcccccgctcaccccgcgcccctacttc
tctccctacgcggtgggccgcgggggcgcccgactcccgctccgcaggggcggcccggct
cacgggacccaaaagcgcaaccagtctcggccgcagccacagccggagccgcagctgccc
accatctatgccatcacgcccacctacagccgcccggtgcagaaagcggagctgacccgc
ctggccaacacgttccgccaggtggcgcagctgcactggatcctggtggaggacgcggcg
gcgcgcagcgagctggtgagccgcttcctggcgcgggccgggctgcccagcactcacctg
cacgtgcccacgccgcggcgctacaagcggcccgggctgccgcgcgccactgagcagcgc
aacgcgggcctcgcctggctgcgccagaggcaccagcaccagcgcgcgcagcccggcgtg
ctcttcttcgctgacgacgacaacacctatagtctggagctcttccaggagatgcgaacc
acccgcaaggtctccgtctggcctgtgggcctggttggtgggcggcgctacgaacgtccg
ctggtggaaaacggcaaagttgttggctggtacaccggctggagagcagacaggcctttt
gccatcgacatggcaggatttgctgtaagtcttcaagtcattttgtccaatccaaaagct
gtatttaagcgtcgtggatcccagccagggatgcaagaatctgactttctcaaacagata
acaacagtcgaagaactggaaccgaaagcaaataactgcactaaggttctcgtgtggcac
actcggacagagaaggttaatctagccaacgagccaaagtaccacctggacacagtgaaa
attgaggtataa

DBGET integrated database retrieval system