KEGG   Homo sapiens (human): 26229Help
Entry
26229             CDS       T01001                                 

Gene name
B3GAT3, GLCATI, glcUAT-I
Definition
beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I) (EC:2.4.1.135)
Orthology
K10158  
galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 [EC:2.4.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate [PATH:hsa00532]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - heparan sulfate / heparin [PATH:hsa00534]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12.3
AA seq 335 aa AA seqDB search
MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRR
PPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPL
VSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKD
PPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFH
TAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAAN
CTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaagctgaagaacgtgtttctcgcctacttcctggtgtcgatcgccggcctc
ctctacgcgctggtacagctcggccagccatgtgactgccttcctcccctgcgggcagca
gccgagcagctacggcagaaggatctgaggatttcccagctgcaagcggaactccgacgg
ccaccccctgcccctgcccagccccctgaacccgaggccctgcctactatctatgttgtt
acccccacctatgccaggctggtacagaaggcagagctggtacgactgtcccagacactg
agcctggtgccccggctgcattggctgctggtggaggatgctgagggtcccaccccgctg
gtctcagggctgctggctgcctctggcctcctcttcacacacctggtggtcctcacgccc
aaagcccagcggcttcgggagggcgagcctggctgggttcatccccgtggtgtcgagcag
cggaacaaggccctggactggctccggggcagagggggtgctgtgggtggggagaaggac
ccaccaccaccagggacccaaggagtcgtctactttgctgacgatgacaacacctacagc
cgggagctgtttgaggagatgcgctggacccgtggtgtctcagtgtggcctgtggggctg
gtgggcggcctgcgattcgagggccctcaggtacaggacggccgggtagtgggcttccac
acagcatgggagcccagcaggcccttccctgtggatatggctggatttgccgtggccctg
cccttgctgttagataagcccaatgcccaatttgattccaccgctccccggggccacctg
gagagcagtcttctgagccaccttgtggatcccaaggacctggagccacgggctgccaac
tgcactcgggtactggtgtggcatactcggacagagaagcccaagatgaagcaggaggag
cagctgcagcggcagggccggggctcagacccagcaattgaggtgtga

DBGET integrated database retrieval system