KEGG   Homo sapiens (human): 26229Help
Entry
26229             CDS       T01001                                 

Gene name
B3GAT3, GLCATI, JDSCD, glcUAT-I
Definition
(RefSeq) beta-1,3-glucuronyltransferase 3
  KO
K10158  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 [EC:2.4.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
hsa01100  Metabolic pathways
Module
hsa_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Disease
H01498  Multiple joint dislocations, short stature, craniofacial dysmorphism, and congenital heart defects (JDSSDHD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    26229 (B3GAT3)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    26229 (B3GAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.135  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
     26229 (B3GAT3)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   26229 (B3GAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_43
Motif
Other DBs
NCBI-GeneID: 26229
NCBI-ProteinID: NP_036332
OMIM: 606374
HGNC: 923
Ensembl: ENSG00000149541
Vega: OTTHUMG00000167685
Pharos: O94766(Tbio)
UniProt: O94766
Structure
PDB: 

Jmol
Position
11q12.3
AA seq 335 aa AA seqDB search
MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRR
PPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPL
VSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKD
PPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFH
TAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAAN
CTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgaagctgaagaacgtgtttctcgcctacttcctggtgtcgatcgccggcctc
ctctacgcgctggtacagctcggccagccatgtgactgccttcctcccctgcgggcagca
gccgagcagctacggcagaaggatctgaggatttcccagctgcaagcggaactccgacgg
ccaccccctgcccctgcccagccccctgaacccgaggccctgcctactatctatgttgtt
acccccacctatgccaggctggtacagaaggcagagctggtacgactgtcccagacactg
agcctggtgccccggctgcattggctgctggtggaggatgctgagggtcccaccccgctg
gtctcagggctgctggctgcctctggcctcctcttcacacacctggtggtcctcacgccc
aaagcccagcggcttcgggagggcgagcctggctgggttcatccccgtggtgtcgagcag
cggaacaaggccctggactggctccggggcagagggggtgctgtgggtggggagaaggac
ccaccaccaccagggacccaaggagtcgtctactttgctgacgatgacaacacctacagc
cgggagctgtttgaggagatgcgctggacccgtggtgtctcagtgtggcctgtggggctg
gtgggcggcctgcgattcgagggccctcaggtacaggacggccgggtagtgggcttccac
acagcatgggagcccagcaggcccttccctgtggatatggctggatttgccgtggccctg
cccttgctgttagataagcccaatgcccaatttgattccaccgctccccggggccacctg
gagagcagtcttctgagccaccttgtggatcccaaggacctggagccacgggctgccaac
tgcactcgggtactggtgtggcatactcggacagagaagcccaagatgaagcaggaggag
cagctgcagcggcagggccggggctcagacccagcaattgaggtgtga

DBGET integrated database retrieval system