KEGG   Homo sapiens (human): 11041Help
Entry
11041             CDS       T01001                                 

Gene name
B3GNT1, B3GN-T1, B3GNT6, BETA3GNTI, MDDGA13, iGAT, iGNT
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1 (EC:2.4.1.149)
Orthology
K00741  
N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase [EC:2.4.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    11041 (B3GNT1)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    11041 (B3GNT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.149  N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase
     11041 (B3GNT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   11041 (B3GNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.2
AA seq 415 aa AA seqDB search
MQMSYAIRCAFYQLLLAALMLVAMLQLLYLSLLSGLHGQEEQDQYFEFFPPSPRSVDQVK
AQLRTALASGGVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPL
SVSVFAATKEEAQLATVLAYALSSHCPDMRARVAMHLVCPSRYEAAVPDPREPGEFALLR
SCQEVFDKLARVAQPGINYALGTNVSYPNNLLRNLAREGANYALVIDVDMVPSEGLWRGL
REMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTN
YSRWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAG
FDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgtcctacgccatccggtgcgccttctaccagctgctgctggccgcgctcatg
ctggtggcgatgctgcagctgctctacctgtcgctgctgtccggactgcacgggcaggag
gagcaagaccaatattttgagttctttcccccgtccccacggtccgtggaccaggtcaag
gcgcagctccgcaccgcgctggcctctggaggcgtcctggacgctagcggcgattaccgc
gtctacaggggcctgctgaagaccaccatggaccccaacgatgtgatcctggccacgcac
gccagcgtggacaacctgctgcacctgtcgggtctgctggagcgctgggagggcccgctg
tccgtgtcggtgttcgcggccaccaaggaggaggcgcagctggccacggtgctggcctac
gcgctgagcagccactgccccgacatgcgcgccagggtcgccatgcacctcgtgtgcccc
tcgcgttacgaggcagccgtgcccgacccccgggagccgggggagtttgccctgctgcgg
tcctgccaggaggtctttgacaagctagccagggtggcccagcccgggattaattatgcg
ctgggcaccaatgtctcctaccccaataacctgctgaggaatctggctcgtgagggggcc
aactatgccctggtgatcgatgtggacatggtgcccagcgaggggctgtggagaggcctg
cgggaaatgctggatcagagcaaccagtggggaggcaccgcgctggtggtgcctgccttc
gaaatccgaagagcccgccgcatgcccatgaacaaaaacgagctggtgcagctctaccag
gttggcgaggtgcggcccttctattatgggttgtgcaccccctgccaggcacccaccaac
tattcccgctgggtcaacctgccggaagagagcttgctgcggcccgcctacgtggtacct
tggcaggacccctgggagccattctacgtggcaggaggcaaggtgcccaccttcgacgag
cgctttcggcagtacggcttcaaccgaatcagccaggcctgcgagctgcatgtggcgggg
tttgattttgaggtcctgaacgaaggtttcttggttcataagggcttcaaagaagcgttg
aagttccatccccaaaaggaggctgaaaatcagcacaataagatcctatatcgccagttc
aaacaggagttgaaggccaagtaccccaactctccccgacgctgctga

DBGET integrated database retrieval system