KEGG   Homo sapiens (human): 10331Help
Entry
10331             CDS       T01001                                 

Gene name
B3GNT3, B3GAL-T8, B3GN-T3, B3GNT-3, HP10328, TMEM3, beta3Gn-T3
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 (EC:2.4.1.146)
Orthology
K07970  
beta-1,3-N-acetylglucosaminyltransferase 3 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    10331 (B3GNT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     10331 (B3GNT3)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   10331 (B3GNT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.1
AA seq 372 aa AA seqDB search
MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAP
CHANTSMVTHPDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNY
VRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHD
SFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFVGQLIQ
NVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFL
GMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYEMLLMWDALNQ
PNLTCGNQTQIY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatctccggcaccggcggcccaatgccaccctcattctggccatcggcgctttc
accctcctcctcttcagtctgctagtgtcaccacccacctgcaaggtccaggagcagcca
ccggcgatccccgaggccctggcctggcccactccacccacccgcccagccccggccccg
tgccatgccaacacctctatggtcacccacccggacttcgccacgcagccgcagcacgtt
cagaacttcctcctgtacagacactgccgccactttcccctgctgcaggacgtgcccccc
tctaagtgcgcgcagccggtcttcctgctgctggtgatcaagtcctcccctagcaactat
gtgcgccgcgagctgctgcggcgcacgtggggccgcgagcgcaaggtacggggtttgcag
ctgcgcctcctcttcctggtgggcacagcctccaacccgcacgaggcccgcaaggtcaac
cggctgctggagctggaggcacagactcacggagacatcctgcagtgggacttccacgac
tccttcttcaacctcacgctcaagcaggtcctgttcttacagtggcaggagacaaggtgc
gccaacgccagcttcgtgctcaacggggatgatgacgtctttgcacacacagacaacatg
gtcttctacctgcaggaccatgaccctggccgccacctcttcgtggggcaactgatccaa
aacgtgggccccatccgggctttttggagcaagtactatgtgccagaggtggtgactcag
aatgagcggtacccaccctattgtgggggtggtggcttcttgctgtcccgcttcacggcc
gctgccctgcgccgtgctgcccatgtcttggacatcttccccattgatgatgtcttcctg
ggtatgtgtctggagcttgagggactgaagcctgcctcccacagcggcatccgcacgtct
ggcgtgcgggctccatcgcaacgcctgtcctcctttgacccctgcttctaccgagacctg
ctgctggtgcaccgcttcctaccttatgagatgctgctcatgtgggatgcgctgaaccag
cccaacctcacctgcggcaatcagacacagatctactga

DBGET integrated database retrieval system