KEGG   Homo sapiens (human): 79369Help
Entry
79369             CDS       T01001                                 

Gene name
B3GNT4, B3GN-T4, beta3Gn-T4
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Orthology
K07971  
beta-1,3-N-acetylglucosaminyltransferase 4 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24
AA seq 378 aa AA seqDB search
MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRKAAKPAGDPT
AHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFL
LLAIKSQPGHVERRAAIRSTWGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDD
ILQWDFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLDGWDPAQD
LLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAEL
FPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMW
ALVTDEGLKCAAGPIPQR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctccccagccttccgcagcccaccagggaaggggcggtaggagtggcctttta
ccaaagggaccggcgatgctctgcaggctgtgctggctggtctcgtacagcttggctgtg
ctgttgctcggctgcctgctcttcctgaggaaggcggccaagcccgcaggagaccccacg
gcccaccagcctttctgggctcccccaacaccccgtcacagccggtgtccacccaaccac
acagtgtctagcgcctctctgtccctgcctagccgtcaccgtctcttcttgacctatcgt
cactgccgaaatttctctatcttgctggagccttcaggctgttccaaggataccttcttg
ctcctggccatcaagtcacagcctggtcacgtggagcgacgtgcggctatccgcagcacg
tggggcagggtggggggatgggctaggggccggcagctgaagctggtgttcctcctaggg
gtggcaggatccgctcccccagcccagctgctggcctatgagagtagggagtttgatgac
atcctccagtgggacttcactgaggacttcttcaacctgacgctcaaggagctgcacctg
cagcgctgggtggtggctgcctgcccccaggcccatttcatgctaaagggagatgacgat
gtctttgtccacgtccccaacgtgttagagttcctggatggctgggacccagcccaggac
ctcctggtgggagatgtcatccgccaagccctgcccaacaggaacactaaggtcaaatac
ttcatcccaccctcaatgtacagggccacccactacccaccctatgctggtgggggagga
tatgtcatgtccagagccacagtgcggcgcctccaggctatcatggaagatgctgaactc
ttccccattgatgatgtctttgtgggtatgtgcctgaggaggctggggctgagccctatg
caccatgctggcttcaagacatttggaatccggcggcccctggaccccttagacccctgc
ctgtatagggggctcctgctggttcaccgcctcagccccctcgagatgtggaccatgtgg
gcactggtgacagatgaggggctcaagtgtgcagctggccccataccccagcgctga

DBGET integrated database retrieval system