KEGG   Homo sapiens (human): 79369Help
Entry
79369             CDS       T01001                                 

Gene name
B3GNT4, B3GN-T4, beta3Gn-T4
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Orthology
K07971  
beta-1,3-N-acetylglucosaminyltransferase 4 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    79369 (B3GNT4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     79369 (B3GNT4)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   79369 (B3GNT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24
AA seq 378 aa AA seqDB search
MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLRKAAKPAGDPT
AHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFL
LLAIKSQPGHVERRAAIRSTWGRVGGWARGRQLKLVFLLGVAGSAPPAQLLAYESREFDD
ILQWDFTEDFFNLTLKELHLQRWVVAACPQAHFMLKGDDDVFVHVPNVLEFLDGWDPAQD
LLVGDVIRQALPNRNTKVKYFIPPSMYRATHYPPYAGGGGYVMSRATVRRLQAIMEDAEL
FPIDDVFVGMCLRRLGLSPMHHAGFKTFGIRRPLDPLDPCLYRGLLLVHRLSPLEMWTMW
ALVTDEGLKCAAGPIPQR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctccccagccttccgcagcccaccagggaaggggcggtaggagtggcctttta
ccaaagggaccggcgatgctctgcaggctgtgctggctggtctcgtacagcttggctgtg
ctgttgctcggctgcctgctcttcctgaggaaggcggccaagcccgcaggagaccccacg
gcccaccagcctttctgggctcccccaacaccccgtcacagccggtgtccacccaaccac
acagtgtctagcgcctctctgtccctgcctagccgtcaccgtctcttcttgacctatcgt
cactgccgaaatttctctatcttgctggagccttcaggctgttccaaggataccttcttg
ctcctggccatcaagtcacagcctggtcacgtggagcgacgtgcggctatccgcagcacg
tggggcagggtggggggatgggctaggggccggcagctgaagctggtgttcctcctaggg
gtggcaggatccgctcccccagcccagctgctggcctatgagagtagggagtttgatgac
atcctccagtgggacttcactgaggacttcttcaacctgacgctcaaggagctgcacctg
cagcgctgggtggtggctgcctgcccccaggcccatttcatgctaaagggagatgacgat
gtctttgtccacgtccccaacgtgttagagttcctggatggctgggacccagcccaggac
ctcctggtgggagatgtcatccgccaagccctgcccaacaggaacactaaggtcaaatac
ttcatcccaccctcaatgtacagggccacccactacccaccctatgctggtgggggagga
tatgtcatgtccagagccacagtgcggcgcctccaggctatcatggaagatgctgaactc
ttccccattgatgatgtctttgtgggtatgtgcctgaggaggctggggctgagccctatg
caccatgctggcttcaagacatttggaatccggcggcccctggaccccttagacccctgc
ctgtatagggggctcctgctggttcaccgcctcagccccctcgagatgtggaccatgtgg
gcactggtgacagatgaggggctcaagtgtgcagctggccccataccccagcgctga

DBGET integrated database retrieval system