KEGG   Homo sapiens (human): 192134Help
Entry
192134            CDS       T01001                                 

Gene name
B3GNT6, B3Gn-T6, BGnT-6, beta-1,3-Gn-T6, beta3Gn-T6
Definition
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 (core 3 synthase) (EC:2.4.1.149)
Orthology
K00739  
acetylgalactosaminyl-0-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase [EC:2.4.1.147]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hsa00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 384 aa AA seqDB search
MAFPCRRSLTAKTLACLLVGVSFLALQQWFLQAPRSPREERSPQEETPEGPTDAPAADEP
PSELVPGPPCVANASANATADFEQLPARIQDFLRYRHCRHFPLLWDAPAKCAGGRGVFLL
LAVKSAPEHYERRELIRRTWGQERSYGGRPVRRLFLLGTPGPEDEARAERLAELVALEAR
EHGDVLQWAFADTFLNLTLKHLHLLDWLAARCPHARFLLSGDDDVFVHTANVVRFLQAQP
PGRHLFSGQLMEGSVPIRDSWSKYFVPPQLFPGSAYPVYCSGGGFLLSGPTARALRAAAR
HTPLFPIDDAYMGMCLERAGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP
YEMLLMWKALHSPALSCDRGHRVS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcttttccctgccgcaggtccctgactgccaagactctggcctgcctcctggtgggc
gtgagtttcttagcactgcagcagtggttcctccaggcgccaaggtccccgcgggaggag
aggtccccgcaggaggagacgccagagggtcccaccgacgctcccgcggctgacgagccg
ccctcggagctcgtccccgggcccccgtgcgtggcgaacgcctcggcgaacgccacggcc
gacttcgagcagctgcccgcgcgcatccaggacttcctgcggtaccgccactgccgccac
ttcccgctgctttgggacgcaccggccaagtgcgccggcggccgaggcgtgttcctgctc
ctggcggtgaagtcggcgcctgagcactacgagcgacgcgagctcatccggcgcacgtgg
gggcaagagcgcagctacggcgggcggccagtgcgccgcctctttctattgggcaccccg
ggccccgaggacgaggcgcgcgcggagcggctggcggagctggtggcgctggaggcgcgc
gagcacggcgacgtgctgcagtgggccttcgcggacaccttcctcaacctcacgctcaag
cacctgcacttgctcgactggctggctgcacgctgcccgcacgcgcgctttctgctcagc
ggcgacgacgacgtgttcgtgcacaccgccaacgtagtccgcttcctgcaggcgcagcca
cccggccgccacctgttctccggccagctcatggagggctccgtgcccatccgcgacagc
tggagcaagtacttcgtgccgccgcagctcttccccgggtccgcttacccggtgtactgc
agcggcggcggcttcctcctgtccggccccacggcccgggccctgcgcgcggccgcccgc
cacaccccgctcttccccatcgacgacgcctacatgggcatgtgtctggagcgcgccggc
ctggcgcccagcggccacgagggcatccgacccttcggcgtgcagctgcctggcgcacag
cagtcctccttcgacccctgcatgtaccgcgagttgctgctagtgcaccgcttcgcgccc
tacgagatgctgctcatgtggaaggcgctgcacagccccgcgctcagctgtgaccgggga
caccgggtctcctga

DBGET integrated database retrieval system