KEGG   Homo sapiens (human): 9331Help
Entry
9331              CDS       T01001                                 

Gene name
B4GALT6, B4Gal-T6, beta4Gal-T6
Definition
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 (EC:2.4.1.274)
Orthology
K07553  
beta-1,4-galactosyltransferase 6 [EC:2.4.1.274]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Lactosylceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    9331 (B4GALT6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.274  glucosylceramide beta-1,4-galactosyltransferase
     9331 (B4GALT6)
Glycosyltransferases [BR:hsa01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   9331 (B4GALT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q11
AA seq 382 aa AA seqDB search
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTI
GHMIRLYTNKNSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLN
VNVSEVSFDEIHQLFSKDLDIEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIP
MLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDSVWDCVIFHDVDHLPENDRNYY
GCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNR
VHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGLNNLIYRPKIL
VDRLYTNISVNLMPELAPIEDY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgctcaggcggatgatgcgggtttccaatcgctctctcctcgccttcatcttc
ttcttctccctctcttcgtcctgtctgtacttcatctatgtggccccaggcatcgccaac
acatatctctttatggtacaagctcgaggtataatgttgagagaaaatgtgaaaacaata
ggtcatatgatcaggctgtacacaaataaaaacagtacgctcaacggtacagattatccc
gaaggcaataattcaagtgattatcttgttcaaacaacaacgtatctcccggaaaacttc
acatactcaccatacctcccctgtccagaaaagctgccttatatgcgaggattcctcaat
gtcaatgtaagcgaagtcagttttgatgaaattcatcaactcttctccaaggatttagat
attgagccagggggtcattggaggccaaaagactgtaaacccagatggaaggtggcagtt
ctcattcctttccgtaatcgccatgaacatcttccaatttttttcttacatctgattcca
atgctccagaagcagcggctggaatttgcgttttatgtcattgaacagactggcacacaa
ccttttaaccgtgcgatgcttttcaatgtgggcttcaaagaggccatgaaagacagtgtc
tgggactgtgtaatcttccacgatgtggatcatctacctgaaaatgaccggaactattac
ggatgtggagaaatgccacgtcattttgctgcaaagctggataaatacatgtatattctt
ccatataaagaattttttggtggtgtaagtgggctgacagtggaacaatttagaaagatc
aatggttttcctaatgccttctggggatggggaggagaagatgatgacctttggaacaga
gttcactatgctggatataatgtaaccagaccagagggagacttaggaaaatacaagtca
attcctcatcaccatagaggtgaagtccagtttttaggacggtataaattactaaggtat
tccaaggagcgtcagtacatcgatggactgaacaatttaatatataggccaaaaatactg
gttgataggttgtatacaaacatatctgtaaacctcatgccagagttagctccaatcgaa
gactattaa

DBGET integrated database retrieval system