KEGG   Homo sapiens (human): 11285Help
Entry
11285             CDS       T01001                                 

Gene name
B4GALT7, EDSP1, XGALT1, XGPT1
Definition
xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (EC:2.4.1.133)
Orthology
K00733  
xylosylprotein 4-beta-galactosyltransferase [EC:2.4.1.133]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    11285 (B4GALT7)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    11285 (B4GALT7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.133  xylosylprotein 4-beta-galactosyltransferase
     11285 (B4GALT7)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   11285 (B4GALT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.2-q35.3
AA seq 327 aa AA seqDB search
MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARA
VRGQGQETSGPPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLS
RKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEA
GPFHVASPELHPLYHYKTYVGGILLLSKQHYRLCNGMSNRFWGWGREDDEFYRRIKGAGL
QLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFKVDREGGLNTVKYHVASRTAL
SVGGAPCTVLNIMLDCDKTATPWCTFS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttcccctcgcggaggaaagcggcgcagctgccctgggaggacggcaggtccgggttg
ctctccggcggcctccctcggaagtgttccgtcttccacctgttcgtggcctgcctctcg
ctgggcttcttctccctactctggctgcagctcagctgctctggggacgtggcccgggca
gtcaggggacaagggcaggagacctcgggccctccccgtgcctgccccccagagccgccc
cctgagcactgggaagaagacgcatcctggggcccccaccgcctggcagtgctggtgccc
ttccgcgaacgcttcgaggagctcctggtcttcgtgccccacatgcgccgcttcctgagc
aggaagaagatccggcaccacatctacgtgctcaaccaggtggaccacttcaggttcaac
cgggcagcgctcatcaacgtgggcttcctggagagcagcaacagcacggactacattgcc
atgcacgacgttgacctgctccctctcaacgaggagctggactatggctttcctgaggct
gggcccttccacgtggcctccccggagctccaccctctctaccactacaagacctatgtc
ggcggcatcctgctgctctccaagcagcactaccggctgtgcaatgggatgtccaaccgc
ttctggggctggggccgcgaggacgacgagttctaccggcgcattaagggagctgggctc
cagcttttccgcccctcgggaatcacaactgggtacaagacatttcgccacctgcatgac
ccagcctggcggaagagggaccagaagcgcatcgcagctcaaaaacaggagcagttcaag
gtggacagggagggaggcctgaacactgtgaagtaccatgtggcttcccgcactgccctg
tctgtgggcggggccccctgcactgtcctcaacatcatgttggactgtgacaagaccgcc
acaccctggtgcacattcagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system