KEGG   Homo sapiens (human): 56913Help
Entry
56913             CDS       T01001                                 

Gene name
C1GALT1, C1GALT, T-synthase
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 (EC:2.4.1.122)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    56913 (C1GALT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     56913 (C1GALT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Type 3 chain
   56913 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p21.3
AA seq 363 aa AA seqDB search
MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLE
GQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLR
WLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIED
LALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKL
GNP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcctggctgaattttttaaccttcctctgtggatcagcaataggattt
cttttatgttctcagctatttagtattttgttgggagaaaaggttgacacccagcctaat
gttcttcataatgatcctcatgcaaggcattcagatgataatggacagaatcatctagaa
ggacaaatgaacttcaatgcagattctagccaacataaagatgagaacacagacattgct
gaaaacctctatcagaaagttagaattctttgctgggttatgaccggccctcaaaaccta
gagaaaaaggccaaacacgtcaaagctacttgggcccagcgttgtaacaaagtgttgttt
atgagttcagaagaaaataaagacttccctgctgtgggactgaaaaccaaagaaggcaga
gatcaactatactggaaaacaattaaagcttttcagtatgttcatgaacattatttagaa
gatgctgattggtttttgaaagcagatgatgacacgtatgtcatactagacaatttgagg
tggcttctttcaaaatacgaccctgaagaacccatttactttgggagaagatttaagcct
tatgtaaagcagggctacatgagtggaggagcaggatatgtactaagcaaagaagccttg
aaaagatttgttgatgcatttaaaacagacaagtgtacacatagttcctccattgaagac
ttagcactggggagatgcatggaaattatgaatgtagaagcaggagattccagagatacc
attggaaaagaaacttttcatccctttgtgccagaacaccatttaattaaaggttatcta
cctagaacgttttggtactggaattacaactattatcctcctgtagagggtcctggttgc
tgctctgatcttgcagtttcttttcactatgttgattctacaaccatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggttatttatacagatatcaacctaccttacct
gaacgtatactaaaggaaattagtcaagcaaacaaaaatgaagatacaaaagtgaagtta
ggaaatccttga

DBGET integrated database retrieval system