KEGG   Homo sapiens (human): 79586Help
Entry
79586             CDS       T01001                                 

Gene name
CHPF, CHSY2, CSS2
Definition
chondroitin polymerizing factor (EC:2.4.1.175 2.4.1.226)
Orthology
K00747  
chondroitin polymerizing factor [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    79586 (CHPF)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     79586 (CHPF)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     79586 (CHPF)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   79586 (CHPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 613 aa AA seqDB search
MAVVTLGEERPIGHLHLALRHLLEQHGDDFDWFFLVPDTTYTEAHGLARLTGHLSLASAA
HLYLGRPQDFIGGEPTPGRYCHGGFGVLLSRMLLQQLRPHLEGCRNDIVSARPDEWLGRC
ILDATGVGCTGDHEGVHYSHLELSPGEPVQEGDPHFRSALTAHPVRDPVHMYQLHKAFAR
AELERTYQEIQELQWEIQNTSHLAVDGDRAAAWPVGIPAPSRPASRFEVLRWDYFTEQHA
FSCADGSPRCPLRGADRADVADVLGTALEELNRRYHPALRLQKQQLVNGYRRFDPARGME
YTLDLQLEALTPQGGRRPLTRRVQLLRPLSRVEILPVPYVTEASRLTVLLPLAAAERDLA
PGFLEAFATAALEPGDAAAALTLLLLYEPRQAQRVAHADVFAPVKAHVAELERRFPGARV
PWLSVQTAAPSPLRLMDLLSKKHPLDTLFLLAGPDTVLTPDFLNRCRMHAISGWQAFFPM
HFQAFHPAVAPPQGPGPPELGRDTGRFDRQAASEACFYNSDYVAARGRLAAASEQEEELL
ESLDVYELFLHFSSLHVLRAVEPALLQRYRAQTCSARLSEDLYHRCLQSVLEGLGSRTQL
AMLLFEQEQGNST
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggtgacgctaggcgaggagcgacccattggacacctgcacctggcgctgcgc
cacctgctggagcagcacggcgacgactttgactggttcttcctggtgcctgacaccacc
tacaccgaggcgcacggcctggcacgcctaactggccacctcagcctggcctccgccgcc
cacctgtacctgggccggccccaggacttcatcggcggagagcccacccccggccgctac
tgccacggaggctttggggtgctgctgtcgcgcatgctgctgcaacaactgcgcccccac
ctggaaggctgccgcaacgacatcgtcagtgcgcgccctgacgagtggctgggtcgctgc
attctcgatgccaccggggtgggctgcactggtgaccacgagggggtgcactatagccat
ctggagctgagccctggggagccagtgcaggagggggaccctcatttccgaagtgccctg
acagcccaccctgtgcgtgaccctgtgcacatgtaccagctgcacaaagctttcgcccga
gctgaactggaacgcacgtaccaggagatccaggagttacagtgggagatccagaatacc
agccatctggccgttgatggggaccgggcagctgcttggcccgtgggtattccagcacca
tcccgcccggcctcccgctttgaggtgctgcgctgggactacttcacggagcagcacgct
ttctcctgcgccgatggctcaccccgctgcccactgcgtggggctgaccgggctgatgtg
gccgatgttctggggacagctctagaggagctgaaccgccgctaccacccggccttgcgg
ctccagaagcagcagctggtgaatggctaccgacgctttgatccggcccggggtatggaa
tacacgctggacttgcagctggaggcactgaccccccagggaggccgccggcccctcact
cgccgagtgcagctgctccggccgctgagccgcgtggagatcttgcctgtgccctatgtc
actgaggcctcacgtctcactgtgctgctgcctctagctgcggctgagcgtgacctggcc
cctggcttcttggaggcctttgccactgcagcactggagcctggtgatgctgcggcagcc
ctgaccctgctgctactgtatgagccgcgccaggcccagcgcgtggcccatgcagatgtc
ttcgcacctgtcaaggcccacgtggcagagctggagcggcgtttccccggtgcccgggtg
ccatggctcagtgtgcagacagccgcaccctcaccactgcgcctcatggatctactctcc
aagaagcacccgctggacacactgttcctgctggccgggccagacacggtgctcacgcct
gacttcctgaaccgctgccgcatgcatgccatctccggctggcaggccttctttcccatg
catttccaagccttccacccagctgtggccccaccacaagggcctgggcccccagagctg
ggccgtgacactggccgctttgatcgccaggcagccagcgaggcctgcttctacaactcc
gactacgtggcagcccgtgggcgcctggcggcagcctcagaacaagaagaggagctgctg
gagagcctggatgtgtacgagctgttcctccacttctccagtctgcatgtgctgcgggcg
gtggagccggcgctgctgcagcgctaccgggcccagacgtgcagcgcgaggctcagtgag
gacctgtaccaccgctgcctccagagcgtgcttgagggcctcggctcccgaacccagctg
gccatgctactctttgaacaggagcagggcaacagcacctga

DBGET integrated database retrieval system