KEGG   Homo sapiens (human): 22856Help
Entry
22856             CDS       T01001                                 

Gene name
CHSY1, CHSY, CSS1, ChSy-1, TPBS
Definition
(RefSeq) chondroitin sulfate synthase 1
  KO
K13499  chondroitin sulfate synthase [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
hsa01100  Metabolic pathways
Module
hsa_M00058  Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Disease
H01497  Temtamy preaxial brachydactyly syndrome (TPBS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    22856 (CHSY1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.175  glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase
     22856 (CHSY1)
    2.4.1.226  N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
     22856 (CHSY1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   22856 (CHSY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHGN Fringe Glyco_transf_7C Glyco_tranf_2_2 Galactosyl_T Glyco_transf_21 BMFP
Motif
Other DBs
NCBI-GeneID: 22856
NCBI-ProteinID: NP_055733
OMIM: 608183
HGNC: 17198
Ensembl: ENSG00000131873
Vega: OTTHUMG00000149873
Pharos: Q86X52(Tbio)
UniProt: Q86X52
Position
15q26.3
AA seq 802 aa AA seqDB search
MAARGRRAWLSVLLGLVLGFVLASRLVLPRASELKRAGPRRRASPEGCRSGQAAASQAGG
ARGDARGAQLWPPGSDPDGGPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVQFF
SSEGSDTSVPIPVVPLRGVDDSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDR
LENFLRSLNSSEPLFLGQTGLGTTEEMGKLALEPGENFCMGGPGVIMSREVLRRMVPHIG
KCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYIRDLHNSKIHQA
ITLHPNKNPPYQYRLHSYMLSRKISELRHRTIQLHREIVLMSKYSNTEIHKEDLQLGIPP
SFMRFQPRQREEILEWEFLTGKYLYSAVDGQPPRRGMDSAQREALDDIVMQVMEMINANA
KTRGRIIDFKEIQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKI
QFVEHEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPL
SGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQ
ILPVSGEFSRALALEVGSSQFNNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIF
SQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLED
VDLFNKVVQAGLKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTYGSTQQLAEM
WLEKNDPSYSKSSNNNGSVRTA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgcggccggcgcgcctggctcagcgtgctgctcgggctcgtcctgggcttc
gtgctggcctcgcggctcgtcctgccccgggcttccgagctgaagcgagcgggcccacgg
cgccgcgccagccccgagggctgccggtccgggcaggcggcggcttcccaggccggcggg
gcgcgcggcgatgcgcgcggggcgcagctctggccgcccggctcggacccagatggcggc
ccgcgcgacaggaactttctcttcgtgggagtcatgaccgcccagaaatacctgcagact
cgggccgtggccgcctacagaacatggtccaagacaattcctgggaaagttcagttcttc
tcaagtgagggttctgacacatctgtaccaattccagtagtgccactacggggtgtggac
gactcctacccgccccagaagaagtccttcatgatgctcaagtacatgcacgaccactac
ttggacaagtatgaatggtttatgagagcagatgatgacgtgtacatcaaaggagaccgt
ctggagaacttcctgaggagtttgaacagcagcgagcccctctttcttgggcagacaggc
ctgggcaccacggaagaaatgggaaaactggccctggagcctggtgagaacttctgcatg
ggggggcctggcgtgatcatgagccgggaggtgcttcggagaatggtgccgcacattggc
aagtgtctccgggagatgtacaccacccatgaggacgtggaggtgggaaggtgtgtccgg
aggtttgcaggggtgcagtgtgtctggtcttatgagatgcagcagcttttttatgagaat
tacgagcagaacaaaaaggggtacattagagatctccataacagtaaaattcaccaagct
atcacattacaccccaacaaaaacccaccctaccagtacaggctccacagctacatgctg
agccgcaagatatccgagctccgccatcgcacaatacagctgcaccgcgaaattgtcctg
atgagcaaatacagcaacacagaaattcataaagaggacctccagctgggaatccctccc
tccttcatgaggtttcagccccgccagcgagaggagattctggaatgggagtttctgact
ggaaaatacttgtattcggcagttgacggccagccccctcgaagaggaatggactccgcc
cagagggaagccttggacgacattgtcatgcaggtcatggagatgatcaatgccaacgcc
aagaccagagggcgcatcattgacttcaaagagatccagtacggctaccgccgggtgaac
cccatgtatggggctgagtacatcctggacctgctgcttctgtacaaaaagcacaaaggg
aagaaaatgacggtccctgtgaggaggcacgcgtatttacagcagactttcagcaaaatc
cagtttgtggagcatgaggagctggatgcacaagagttggccaagagaatcaatcaggaa
tctggatccttgtcctttctctcaaactccctgaagaagctcgtcccctttcagctccct
gggtcgaagagtgagcacaaagaacccaaagataaaaagataaacatactgattcctttg
tctgggcgtttcgacatgtttgtgagatttatgggaaactttgagaagacgtgtcttatc
cccaatcagaacgtcaagctcgtggttctgcttttcaattctgactccaaccctgacaag
gccaaacaagttgaactgatgagagattaccgcattaagtaccctaaagccgacatgcag
attttgcctgtgtctggagagttttcaagagccctggccctggaagtaggatcctcccag
tttaacaatgaatctttgctcttcttctgcgacgtcgacctcgtgtttactacagaattc
cttcagcgatgtcgagcaaatacagttctgggccaacaaatatattttccaatcatcttc
agccagtatgacccaaagattgtttatagtgggaaagttcccagtgacaaccattttgcc
tttactcagaaaactggcttctggagaaactatgggtttggcatcacgtgtatttataag
ggagatcttgtccgagtgggtggctttgatgtttccatccaaggctgggggctggaggat
gtggaccttttcaacaaggttgtccaggcaggtttgaagacgtttaggagccaggaagta
ggagtagtccacgtccaccatcctgtcttttgtgatcccaatcttgaccccaaacagtac
aaaatgtgcttggggtccaaagcatcgacctatgggtccacccagcagctggctgagatg
tggctggaaaaaaatgatccaagttacagtaaaagcagcaataataatggctcagtgagg
acagcctaa

DBGET integrated database retrieval system