KEGG   Homo sapiens (human): 22856Help
Entry
22856             CDS       T01001                                 

Gene name
CHSY1, CHSY, CSS1, ChSy-1, TPBS
Definition
chondroitin sulfate synthase 1 (EC:2.4.1.175 2.4.1.226)
Orthology
K13499  
chondroitin sulfate synthase [EC:2.4.1.175 2.4.1.226]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, chondroitin sulfate backbone
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate [PATH:hsa00532]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 802 aa AA seqDB search
MAARGRRAWLSVLLGLVLGFVLASRLVLPRASELKRAGPRRRASPEGCRSGQAAASQAGG
ARGDARGAQLWPPGSDPDGGPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVQFF
SSEGSDTSVPIPVVPLRGVDDSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDR
LENFLRSLNSSEPLFLGQTGLGTTEEMGKLALEPGENFCMGGPGVIMSREVLRRMVPHIG
KCLREMYTTHEDVEVGRCVRRFAGVQCVWSYEMQQLFYENYEQNKKGYIRDLHNSKIHQA
ITLHPNKNPPYQYRLHSYMLSRKISELRHRTIQLHREIVLMSKYSNTEIHKEDLQLGIPP
SFMRFQPRQREEILEWEFLTGKYLYSAVDGQPPRRGMDSAQREALDDIVMQVMEMINANA
KTRGRIIDFKEIQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSKI
QFVEHEELDAQELAKRINQESGSLSFLSNSLKKLVPFQLPGSKSEHKEPKDKKINILIPL
SGRFDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDKAKQVELMRDYRIKYPKADMQ
ILPVSGEFSRALALEVGSSQFNNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIF
SQYDPKIVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLVRVGGFDVSIQGWGLED
VDLFNKVVQAGLKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCLGSKASTYGSTQQLAEM
WLEKNDPSYSKSSNNNGSVRTA
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgcggccggcgcgcctggctcagcgtgctgctcgggctcgtcctgggcttc
gtgctggcctcgcggctcgtcctgccccgggcttccgagctgaagcgagcgggcccacgg
cgccgcgccagccccgagggctgccggtccgggcaggcggcggcttcccaggccggcggg
gcgcgcggcgatgcgcgcggggcgcagctctggccgcccggctcggacccagatggcggc
ccgcgcgacaggaactttctcttcgtgggagtcatgaccgcccagaaatacctgcagact
cgggccgtggccgcctacagaacatggtccaagacaattcctgggaaagttcagttcttc
tcaagtgagggttctgacacatctgtaccaattccagtagtgccactacggggtgtggac
gactcctacccgccccagaagaagtccttcatgatgctcaagtacatgcacgaccactac
ttggacaagtatgaatggtttatgagagcagatgatgacgtgtacatcaaaggagaccgt
ctggagaacttcctgaggagtttgaacagcagcgagcccctctttcttgggcagacaggc
ctgggcaccacggaagaaatgggaaaactggccctggagcctggtgagaacttctgcatg
ggggggcctggcgtgatcatgagccgggaggtgcttcggagaatggtgccgcacattggc
aagtgtctccgggagatgtacaccacccatgaggacgtggaggtgggaaggtgtgtccgg
aggtttgcaggggtgcagtgtgtctggtcttatgagatgcagcagcttttttatgagaat
tacgagcagaacaaaaaggggtacattagagatctccataacagtaaaattcaccaagct
atcacattacaccccaacaaaaacccaccctaccagtacaggctccacagctacatgctg
agccgcaagatatccgagctccgccatcgcacaatacagctgcaccgcgaaattgtcctg
atgagcaaatacagcaacacagaaattcataaagaggacctccagctgggaatccctccc
tccttcatgaggtttcagccccgccagcgagaggagattctggaatgggagtttctgact
ggaaaatacttgtattcggcagttgacggccagccccctcgaagaggaatggactccgcc
cagagggaagccttggacgacattgtcatgcaggtcatggagatgatcaatgccaacgcc
aagaccagagggcgcatcattgacttcaaagagatccagtacggctaccgccgggtgaac
cccatgtatggggctgagtacatcctggacctgctgcttctgtacaaaaagcacaaaggg
aagaaaatgacggtccctgtgaggaggcacgcgtatttacagcagactttcagcaaaatc
cagtttgtggagcatgaggagctggatgcacaagagttggccaagagaatcaatcaggaa
tctggatccttgtcctttctctcaaactccctgaagaagctcgtcccctttcagctccct
gggtcgaagagtgagcacaaagaacccaaagataaaaagataaacatactgattcctttg
tctgggcgtttcgacatgtttgtgagatttatgggaaactttgagaagacgtgtcttatc
cccaatcagaacgtcaagctcgtggttctgcttttcaattctgactccaaccctgacaag
gccaaacaagttgaactgatgagagattaccgcattaagtaccctaaagccgacatgcag
attttgcctgtgtctggagagttttcaagagccctggccctggaagtaggatcctcccag
tttaacaatgaatctttgctcttcttctgcgacgtcgacctcgtgtttactacagaattc
cttcagcgatgtcgagcaaatacagttctgggccaacaaatatattttccaatcatcttc
agccagtatgacccaaagattgtttatagtgggaaagttcccagtgacaaccattttgcc
tttactcagaaaactggcttctggagaaactatgggtttggcatcacgtgtatttataag
ggagatcttgtccgagtgggtggctttgatgtttccatccaaggctgggggctggaggat
gtggaccttttcaacaaggttgtccaggcaggtttgaagacgtttaggagccaggaagta
ggagtagtccacgtccaccatcctgtcttttgtgatcccaatcttgaccccaaacagtac
aaaatgtgcttggggtccaaagcatcgacctatgggtccacccagcagctggctgagatg
tggctggaaaaaaatgatccaagttacagtaaaagcagcaataataatggctcagtgagg
acagcctaa

DBGET integrated database retrieval system