KEGG   Homo sapiens (human): 8818Help
Entry
8818              CDS       T01001                                 

Gene name
DPM2, CDG1U
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 2, regulatory
  KO
K09658  dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
hsa01100  Metabolic pathways
Disease
H00118  Congenital disorders of glycosylation (CDG) type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    8818 (DPM2)
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    8818 (DPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DPM2 PIG-P
Motif
Other DBs
NCBI-GeneID: 8818
NCBI-ProteinID: NP_003854
OMIM: 603564
HGNC: 3006
Ensembl: ENSG00000136908
Vega: OTTHUMG00000020725
Pharos: O94777(Tdark)
UniProt: O94777
Position
9q34.11
AA seq 84 aa AA seqDB search
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLL
LLLFVGLFISYVMLKTKRVTKKAQ
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggccacggggacagaccaggtggtgggactcggcctcgtcgccgttagcctgatcatc
ttcacctactacaccgcctgggtgattctcttgccattcatcgacagtcagcatgtcatc
cacaagtatttcctgccccgagcctatgctgtcgccatcccactggctgcaggcctcctg
ctgctcctgtttgtgggactgttcatctcctatgtgatgctgaagaccaagagagtgacc
aagaaggctcagtga

DBGET integrated database retrieval system