KEGG   Homo sapiens (human): 8818Help
Entry
8818              CDS       T01001                                 

Gene name
DPM2, CDG1U
Definition
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit (EC:2.4.1.83)
Orthology
K09658  
dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
N-Glycan biosynthesis
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:hsa00510]
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:hsa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.13
AA seq 84 aa AA seqDB search
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLL
LLLFVGLFISYVMLKTKRVTKKAQ
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atggccacggggacagaccaggtggtgggactcggcctcgtcgccgttagcctgatcatc
ttcacctactacaccgcctgggtgattctcttgccattcatcgacagtcagcatgtcatc
cacaagtatttcctgccccgagcctatgctgtcgccatcccactggctgcaggcctcctg
ctgctcctgtttgtgggactgttcatctcctatgtgatgctgaagaccaagagagtgacc
aagaaggctcagtga

DBGET integrated database retrieval system