KEGG   Homo sapiens (human): 2131Help
Entry
2131              CDS       T01001                                 

Gene name
EXT1, EXT, LGCR, LGS, TRPS2, TTV
Definition
exostosin glycosyltransferase 1 (EC:2.4.1.225 2.4.1.224)
Orthology
K02366  
glucuronyl/N-acetylglucosaminyl transferase EXT1 [EC:2.4.1.224 2.4.1.225]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, heparan sulfate backbone
Disease
H00122  
Multiple exostoses
H00493  
Heparan sulfate proteoglycan gene defects
H00977  
Trichorhinophalangeal dysplasia
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - heparan sulfate / heparin [PATH:hsa00534]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
8q24.11
AA seq 746 aa AA seqDB search
MQAKKRYFILLSAGSCLALLFYFGGLQFRASRSHSRREEHSGRNGLHHPSPDHFWPRFPD
ALRPFVPWDQLENEDSSVHISPRQKRDANSSIYKGKKCRMESCFDFTLCKKNGFKVYVYP
QQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDRDQLSPQYVHNLRSKVQS
LHLWNNGRNHLIFNLYSGTWPDYTEDVGFDIGQAMLAKASISTENFRPNFDVSIPLFSKD
HPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRNALYHVHNGEDVVLLTTCKH
GKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVML
SNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDKILALRQQTQFLWEAYFSSVE
KIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLPQYSSYLGDFPYYYANLGLKPPSKF
TAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLWNCDKPLPAKHRWPATAVPVVVIE
GESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEVDFAFTVWQSFPERIVGYPARSHFWD
NSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYSHYLPASLKNMVDQLANCEDILMNFL
VSAVTKLPPIKVTQKKQYKETMMGQTSRASRWADPDHFAQRQSCMNTFASWFGYMPLIHS
QMRLDPVLFKDQVSILRKKYRDIERL
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccaaaaaacgctatttcatcctgctctcagctggctcttgtctcgcccttttg
ttttatttcggaggcttgcagtttagggcatcgaggagccacagccggagagaagaacac
agcggtaggaatggcttgcaccaccccagtccggatcatttctggccccgcttcccggac
gctctgcgccccttcgttccttgggatcaattggaaaacgaggattccagcgtgcacatt
tccccccggcagaagcgagatgccaactccagcatctacaaaggcaagaagtgccgcatg
gagtcctgcttcgatttcaccctttgcaagaaaaacggcttcaaagtctacgtataccca
cagcaaaaaggggagaaaatcgccgaaagttaccaaaacattctagcggccatcgagggc
tccaggttctacacctcggaccccagccaggcgtgcctctttgtcctgagtctggatact
ttagacagagaccagttgtcacctcagtatgtgcacaatttgagatccaaagtgcagagt
ctccacttgtggaacaatggtaggaatcatttaatttttaatttatattccggcacttgg
cctgactacaccgaggacgtggggtttgacatcggccaggcgatgctggccaaagccagc
atcagtactgaaaacttccgacccaactttgatgtttctattcccctcttttctaaggat
catcccaggacaggaggggagagggggtttttgaagttcaacaccatccctcctctcagg
aagtacatgctggtattcaaggggaagaggtacctgacagggataggatcagacaccagg
aatgccttatatcacgtccataacggggaggacgttgtgctcctcaccacctgcaagcat
ggcaaagactggcaaaagcacaaggattctcgctgtgacagagacaacaccgagtatgag
aagtatgattatcgggaaatgctgcacaatgccactttctgtctggttcctcgtggtcgc
aggcttgggtccttcagattcctggaggctttgcaggctgcctgcgtccctgtgatgctc
agcaatggatgggagttgccattctctgaagtgattaattggaaccaagctgccgtcata
ggcgatgagagattgttattacagattccttctacaatcaggtctattcatcaggataaa
atcctagcacttagacagcagacacaattcttgtgggaggcttatttttcttcagttgag
aagattgtattaactacactagagattattcaggacagaatattcaagcacatatcacgt
aacagtttaatatggaacaaacatcctggaggattgttcgtactaccacagtattcatct
tatctgggagattttccttactactatgctaatttaggtttaaagcccccctccaaattc
actgcagtcatccatgcggtgacccccctggtctctcagtcccagccagtgttgaagctt
ctcgtggctgcagccaagtcccagtactgtgcccagatcatagttctatggaattgtgac
aagcccctaccagccaaacaccgctggcctgccactgctgtgcctgtcgtcgtcattgaa
ggagagagcaaggttatgagcagccgttttctgccctacgacaacatcatcacagacgcc
gtgctcagccttgacgaggacacggtgctttcaacaacagaggtggatttcgccttcaca
gtgtggcagagcttccctgagaggattgtggggtaccccgcgcgcagccacttctgggat
aactctaaggagcggtggggatacacatcaaagtggacgaacgactactccatggtgttg
acaggagctgctatttaccacaaatattatcactacctatactcccattacctgccagcc
agcctgaagaacatggtggaccaattggccaattgtgaggacattctcatgaacttcctg
gtgtctgctgtgacaaaattgcctccaatcaaagtgacccagaagaagcagtataaggag
acaatgatgggacagacttctcgggcttcccgttgggctgaccctgaccactttgcccag
cgacagagctgcatgaatacgtttgccagctggtttggctacatgccgctgatccactct
cagatgaggctcgaccccgtcctctttaaagaccaggtctctattttgaggaagaaatac
cgagacattgagcgactttga

DBGET integrated database retrieval system