KEGG   Homo sapiens (human): 2134Help
Entry
2134              CDS       T01001                                 

Gene name
EXTL1, EXTL
Definition
exostosin-like glycosyltransferase 1 (EC:2.4.1.224)
Orthology
K02368  
alpha-1,4-N-acetylglucosaminyltransferase EXTL1 [EC:2.4.1.224]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, heparan sulfate backbone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    2134 (EXTL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.224  glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
     2134 (EXTL1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   2134 (EXTL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.1
AA seq 676 aa AA seqDB search
MQSWRRRKSLWLALSASWLLLVLLGGFSLLRLALPPRPRPGASQGWPRWLDAELLQSFSQ
PGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEG
SRFYTFSPAGACLLLLLSLDAQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMV
AEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTAD
TGSSACPWDGRCEQDPGPGQTQRQETLPNATFCLISGHRPEAASRFLQALQAGCIPVLLS
PRWELPFSEVIDWTKAAIVADERLPLQVLAALQEMSPARVLALRQQTQFLWDAYFSSVEK
VIHTTLEVIQDRIFGTSAHPSLLWNSPPGALLALSTFSTSPQDFPFYYLQQGSRPEGRFS
ALIWVGPPGQPPLKLIQAVAGSQHCAQILVLWSNERPLPSRWPETAVPLTVIDGHRKVSD
RFYPYSTIRTDAILSLDARSSLSTSEVDFAFLVWQSFPERMVGFLTSSHFWDEAHGGWGY
TAERTNEFSMVLTTAAFYHRYYHTLFTHSLPKALRTLADEAPTCVDVLMNFIVAAVTKLP
PIKVPYGKQRQEAAPLAPGGPGPRPKPPAPAPDCINQIAAAFGHMPLLSSRLRLDPVLFK
DPVSVQRKKYRSLEKP
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcgtggaggagaagaaagtccctgtggctggcactgtcagcctcctggctcctg
cttgtcctgctgggaggcttctcccttctccgcctggcattgcctcccagacctcggccc
ggggcttcccaaggctggccccgctggctggatgcagagctcctgcagagcttctcccag
cctggagagctcccagaagatgccgtttcacctcctcaagcccctcatggtggcagctgc
aactgggaatcttgctttgatacctcaaagtgcaggggcgatggccttaaggtattcgtg
tacccagcggttggaaccatctctgagactcatcgcaggatcctggcttccattgagggc
tctcgcttctacacattcagccctgctggggcctgcctcctcctcctcctcagcctggac
gcccagactggagagtgcagctcaatgcctctgcaatggaacaggggcaggaaccatctg
gtcctccgtctccacccggctccctgccccaggaccttccagctgggacaggctatggtg
gctgaggccagccccacggtggactccttccggcccggctttgatgtggccctccctttt
ctccctgaagcccacccgttgcgaggtggggctcctggccagctgcggcaacacagcccc
cagcccggggtagccctgctagccctggaagaggagaggggtgggtggcgcacagcagac
actggctcctctgcctgcccctgggatgggcgctgtgagcaagaccctggacctgggcag
acccagcgccaggagacgctgcccaatgccaccttctgcctcatctctggccaccgtccc
gaggctgcctcgcgcttcctccaagccctgcaggccggctgcatcccagtgcttctcagc
ccccgctgggagctgcccttctccgaggtcatcgactggaccaaggcagccatcgtagct
gatgagaggctcccacttcaggtcctggctgccctccaggagatgtcccctgcacgggtc
ctcgccctgcgtcagcagacccagtttctatgggatgcctacttctcctcagtggagaag
gtcatccataccactctggaggttattcaggaccggatttttggaacatcagctcacccc
tcactgctgtggaacagccccccaggggcactcctggccctgtctactttttccacaagc
ccccaggacttccccttctactacctgcaacagggctcccgccctgagggcagattcagc
gccctgatctgggtggggcccccaggccagccccctctgaagctcatccaggcggtggca
ggctcccagcactgtgcccagatcttggttctctggagcaatgagaggccactcccatcc
aggtggccggagacagctgtgcccttgacagtcattgatgggcacaggaaggttagtgat
cgcttctacccatatagcaccatcagaacagatgccatcctcagcctcgatgcccgcagc
agtctttccacaagtgaggtggactttgcctttctggtgtggcagagcttcccagagcgg
atggtgggcttcctgacgtcgagccatttctgggacgaggcccatggtggctggggctac
actgctgagaggaccaacgaattctccatggttctcaccacagccgccttctaccatagg
tattaccacactctcttcacccactccctgcccaaggctctgaggaccctggcagatgag
gcacccacctgtgtggacgtcctgatgaatttcatagtagcagcagtcaccaagctgccc
cctatcaaggtgccctatggcaagcagcgccaggaggctgctccactggcgcctgggggc
ccggggcccaggccaaagccgcctgccccagcccccgactgcatcaaccagatagcggca
gcgttcggccacatgcccttgctgtcctctcgtctgcgtctggacccggtgctgtttaag
gacccggtgtccgtgcagcgcaagaagtaccgcagcctggagaagccctag

DBGET integrated database retrieval system