KEGG   Homo sapiens (human): 2135Help
Entry
2135              CDS       T01001                                 

Gene name
EXTL2, EXTR2
Definition
exostosin-like glycosyltransferase 2 (EC:2.4.1.223)
Orthology
K02369  
alpha-1,4-N-acetylglucosaminyltransferase EXTL2 [EC:2.4.1.223]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Metabolic pathways
Module
Glycosaminoglycan biosynthesis, heparan sulfate backbone
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan biosynthesis - heparan sulfate / heparin [PATH:hsa00534]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p21
AA seq 330 aa AA seqDB search
MRCCHICKLPGRVMGIRVLRLSLVVILVLLLVAGALTALLPSVKEDKMLMLRREIKSQGK
STMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIP
VIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPR
KHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDT
QNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKL
VNIYDSMPLRYSNIMISQFGFPYANYKRKI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgttgccacatctgcaaacttcctgggagagtaatggggattcgagtgcttcga
ttatctttggtggtcatcctcgtattattactggtagctggtgctttgactgccttactt
cccagtgttaaagaagacaagatgctcatgttgcgtagggaaataaaatcccagggcaag
tccaccatggactcctttactctcataatgcagacgtacaacagaacagatctcttattg
aaacttttaaatcattatcaggctgtaccaaatctgcacaaagtgattgtggtatggaac
aatattggagagaaggcaccagatgaattatggaattctctagggccccaccctatccct
gtgatcttcaaacaacagacagcaaacaggatgagaaatcgactccaggtctttcctgaa
ctggaaaccaatgcagtgttgatggtagatgatgacacactcatcagcaccccagacctt
gtttttgctttctcagtttggcagcaatttcctgatcaaattgtaggatttgttcctaga
aagcacgtctctacttcatcaggtatctacagttatggaagttttgaaatgcaagcacca
gggtctggaaatggtgaccagtactctatggtgctgattggagcctcattcttcaatagc
aaatatcttgaattatttcagaggcaacctgcagctgtccatgctttgatagatgatact
caaaactgtgatgatattgccatgaattttatcattgccaagcatattggcaagacttca
gggatatttgtgaagcctgtaaacatggacaatttggaaaaagaaaccaacagtggctat
tctggaatgtggcatcgagctgagcacgctctgcagaggtcttattgtataaataagctt
gttaatatctatgatagcatgcccttaagatactccaacattatgatttcccagtttggt
tttccatatgccaactacaaaagaaaaatataa

DBGET integrated database retrieval system