KEGG   Homo sapiens (human): 2519Help
Entry
2519              CDS       T01001                                 

Gene name
FUCA2, dJ20N2.5
Definition
fucosidase, alpha-L- 2, plasma (EC:3.2.1.51)
Orthology
K01206  
alpha-L-fucosidase [EC:3.2.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    2519 (FUCA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     2519 (FUCA2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2519 (FUCA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q24
AA seq 467 aa AA seqDB search
MRPQELPRLAFPLLLLLLLLLPPPPCPAHSATRFDPTWESLDARQLPAWFDQAKFGIFIH
WGVFSVPSFGSEWFWWYWQKEKIPKYVEFMKDNYPPSFKYEDFGPLFTAKFFNANQWADI
FQASGAKYIVLTSKHHEGFTLWGSEYSWNWNAIDEGPKRDIVKELEVAIRNRTDLRFGLY
YSLFEWFHPLFLEDESSSFHKRQFPVSKTLPELYELVNNYQPEVLWSDGDGGAPDQYWNS
TGFLAWLYNESPVRGTVVTNDRWGAGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKL
SWGYRREAGISDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGTISVVFEERLRQMGSWL
KVNGEAIYETHTWRSQNDTVTPDVWYTSKPKEKLVYAIFLKWPTSGQLFLGHPKAILGAT
EVKLLGHGQPLNWISLEQNGIMVELPQLTIHQMPCKWGWALALTNVI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcggccccaggagctccccaggctcgcgttcccgttgctgctgttgctgttgctgctg
ctgccgccgccgccgtgccctgcccacagcgccacgcgcttcgaccccacctgggagtcc
ctggacgcccgccagctgcccgcgtggtttgaccaggccaagttcggcatcttcatccac
tggggagtgttttccgtgcccagcttcggtagcgagtggttctggtggtattggcaaaag
gaaaagataccgaagtatgtggaatttatgaaagataattaccctcctagtttcaaatat
gaagattttggaccactatttacagcaaaattttttaatgccaaccagtgggcagatatt
tttcaggcctctggtgccaaatacattgtcttaacttccaaacatcatgaaggctttacc
ttgtgggggtcagaatattcgtggaactggaatgccatagatgaggggcccaagagggac
attgtcaaggaacttgaggtagccattaggaacagaactgacctgcgttttggactgtac
tattccctttttgaatggtttcatccgctcttccttgaggatgaatccagttcattccat
aagcggcaatttccagtttctaagacattgccagagctctatgagttagtgaacaactat
cagcctgaggttctgtggtcggatggtgacggaggagcaccggatcaatactggaacagc
acaggcttcttggcctggttatataatgaaagcccagttcggggcacagtagtcaccaat
gatcgttggggagctggtagcatctgtaagcatggtggcttctatacctgcagtgatcgt
tataacccaggacatcttttgccacataaatgggaaaactgcatgacaatagacaaactg
tcctggggctataggagggaagctggaatctctgactatcttacaattgaagaattggtg
aagcaacttgtagagacagtttcatgtggaggaaatcttttgatgaatattgggcccaca
ctagatggcaccatttctgtagtttttgaggagcgactgaggcaaatggggtcctggcta
aaagtcaatggagaagctatttatgaaacccatacctggcgatcccagaatgacactgtc
accccagatgtgtggtacacatccaagcctaaagaaaaattagtctatgccatttttctt
aaatggcccacatcaggacagctgttccttggccatcccaaagctattctgggggcaaca
gaggtgaaactactgggccatggacagccacttaactggatttctttggagcaaaatggc
attatggtagaactgccacagctaaccattcatcagatgccgtgtaaatggggctgggct
ctagccctgactaatgtgatctaa

DBGET integrated database retrieval system