KEGG   Homo sapiens (human): 170384Help
Entry
170384            CDS       T01001                                 

Gene name
FUT11
Definition
(RefSeq) fucosyltransferase 11
  KO
K11257  galactoside 3-L-fucosyltransferase 11 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     170384 (FUT11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_10 Glyco_tran_10_N
Motif
Other DBs
NCBI-GeneID: 170384
NCBI-ProteinID: NP_775811
OMIM: 616932
HGNC: 19233
Ensembl: ENSG00000196968
Vega: OTTHUMG00000018483
Pharos: Q495W5(Tdark)
UniProt: Q495W5
Position
10q22.2
AA seq 492 aa AA seqDB search
MAAGPIRVVLVLLGVLSVCAASGHGSVAEREAGGEAEWAEPWDGAVFRPPSALGAVGVTR
SSGTPRPGREEAGDLPVLLWWSPGLFPHFPGDSERIECARGACVASRNRRALRDSRTRAL
LFYGTDFRASAAPLPRLAHQSWALLHEESPLNNFLLSHGPGIRLFNLTSTFSRHSDYPLS
LQWLPGTAYLRRPVPPPMERAEWRRRGYAPLLYLQSHCDVPADRDRYVRELMRHIPVDSY
GKCLQNRELPTARLQDTATATTEDPELLAFLSRYKFHLALENAICNDYMTEKLWRPMHLG
AVPVYRGSPSVRDWMPNNHSVILIDDFESPQKLAEFIDFLDKNDEEYMKYLAYKQPGGIT
NQFLLDSLKHREWGVNDPLLPNYLNGFECFVCDYELARLDAEKAHAASPGDSPVFEPHIA
QPSHMDCPVPTPGFGNVEEIPENDSWKEMWLQDYWQGLDQGEALTAMIHNNETEQTKFWD
YLHEIFMKRQHL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggccccattagggtggtgttggtccttctaggggtgctcagtgtctgtgca
gccagcggccatgggtccgtagcggagagggaggccggcggggaggcggagtgggcggaa
ccgtgggatggcgcggttttccggccgccctcggcgctgggcgcagtgggggtgacgcgc
agctctgggacgccgcggccagggagggaggaggcgggggacttgccggtactgctgtgg
tggagcccagggctattcccccacttcccgggagactcggagcgcatcgagtgtgcgcgc
ggcgcgtgcgtggcgtcccggaaccgccgagcgctgagggactcgcggacgcgcgcgctg
ctcttctacggcacagacttccgcgcgtcggccgccccgctgccgcgcctggcgcaccag
agctgggcgctcctccacgaggagtcgcccctcaacaacttcttgctgagccacggcccg
ggcatccgcctcttcaatcttacctccaccttcagtcgccactcggattacccgctgtcg
ctgcagtggctgcccgggaccgcctatctgcgccgcccggtgcctccgcccatggaacgc
gcggagtggcgccgccgcggctacgcgccgctgctctatctgcagtcacactgcgacgtg
ccagcggaccgggaccgctacgtgcgcgagctcatgcgccacatcccggtagactcctac
gggaaatgcctgcagaatcgggagctgcctaccgcgcggctacaggacacagccacggcc
accaccgaggatccagagctcttggctttcttgtcccgctataagttccacttggccctg
gaaaatgccatctgtaacgactacatgacagaaaaactgtggcgtcccatgcacctgggc
gctgtgcccgtgtaccgcggttctccctctgtgagggactggatgccgaacaatcactcc
gtcatcctgattgatgattttgagtctcctcagaagctggcagagtttattgactttctg
gacaagaatgatgaggagtatatgaaatacctggcatacaagcaacctgggggcatcacc
aaccaatttcttctggatagtctgaagcatcgggagtggggagtgaatgatcctttgctg
cctaactacctcaacggcttcgagtgtttcgtctgtgactacgaactggctcggctggat
gccgagaaagcccacgcggcctctcccggggacagccccgtctttgagccccacattgcc
cagccctcacacatggactgcccagtgcccacacctggctttggcaatgtggaagagatt
cctgagaatgacagttggaaagagatgtggctgcaagattattggcaaggtctggaccag
ggggaagctctcactgccatgatccacaacaatgaaacagagcagacgaaattttgggat
tacctacatgaaatcttcatgaagaggcaacatctctaa

DBGET integrated database retrieval system