KEGG   Homo sapiens (human): 2524Help
Entry
2524              CDS       T01001                                 

Gene name
FUT2, B12QTL1, SE, SEC2, Se2, sej
Definition
fucosyltransferase 2 (secretor status included) (EC:2.4.1.69)
Orthology
K00718  
galactoside 2-L-fucosyltransferase 1/2 [EC:2.4.1.69]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2524 (FUT2)
   00603 Glycosphingolipid biosynthesis - globo series
    2524 (FUT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.69  galactoside 2-alpha-L-fucosyltransferase
     2524 (FUT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  ABO blood group
   2524 (FUT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3
AA seq 343 aa AA seqDB search
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQL
RGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATAS
RIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQK
FLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFV
VTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTG
GDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcgttcagatgcctttctcctttcccatggcccacttcatcctctttgtcttt
acggtttccactatatttcacgttcagcagcggctagcgaagattcaagccatgtgggag
ttaccggtgcagataccagtgctagcctcaacatcaaaggcactgggacccagccagctc
agggggatgtggacgatcaatgcaataggccgcctggggaaccagatgggcgagtacgcc
acactgtacgccctggccaagatgaacgggcggcccgccttcatcccggcccagatgcac
agcaccctggcccccatcttcagaatcaccctgccggtgctgcacagcgccacggccagc
aggatcccctggcagaactaccacctgaacgactggatggaggaggaataccgccacatc
ccgggggagtacgtccgcttcaccggctacccctgctcctggaccttctaccaccacctc
cgccaggagatcctccaggagttcaccctgcacgaccacgtgcgggaggaggcccagaag
ttcctgcggggcctgcaggtgaacgggagccggccgggcacctttgtaggggtccatgtt
cgccgaggggactatgtccatgtcatgccaaaagtgtggaagggggtggtggccgaccgg
cgatacctacagcaggccctggactggttccgagctcgctacagctccctcatcttcgtg
gtcaccagtaatggcatggcctggtgtcgggagaacattgacacctcccacggtgatgtg
gtgtttgctggcgatggcattgagggctcacctgccaaagattttgctctactcacacag
tgtaaccacaccatcatgaccattgggacgttcgggatctgggccgcatacctcacgggc
ggagacaccatctacctggccaattacaccctccccgactcccctttcctcaaaatcttt
aagccagaggcagccttcctgccggagtggacagggattgccgcagacctgtccccctta
ctcaagcactaa

DBGET integrated database retrieval system