KEGG   Homo sapiens (human): 2525Help
Entry
2525              CDS       T01001                                 

Gene name
FUT3, CD174, FT3B, FucT-III, LE, Les
Definition
fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group) (EC:2.4.1.65)
Orthology
K00716  
galactoside 3(4)-fucosyltransferase 3 [EC:2.4.1.65]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2525 (FUT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.65  3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase
     2525 (FUT3)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Lewis blood group
   2525 (FUT3)
Cellular antigens [BR:hsa04090]
 Proteins
  2525 (FUT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 361 aa AA seqDB search
MDPLGAAKPQWPWRRCLAALLFQLLVAVCFFSYLRVSRDDATGSPRAPSGSSRQDTTPTR
PTLLILLWTWPFHIPVALSRCSEMVPGTADCHITADRKVYPQADTVIVHHWDIMSNPKSR
LPPSPRPQGQRWIWFNLEPPPNCQHLEALDRYFNLTMSYRSDSDIFTPYGWLEPWSGQPA
HPPLNLSAKTELVAWAVSNWKPDSARVRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSR
YKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPK
DLARYLQELDKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAWF
T
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatcccctgggtgcagccaagccacaatggccatggcgccgctgtctggccgcactg
ctatttcagctgctggtggctgtgtgtttcttctcctacctgcgtgtgtcccgagacgat
gccactggatcccctagggctcccagtgggtcctcccgacaggacaccactcccacccgc
cccaccctcctgatcctgctatggacatggcctttccacatccctgtggctctgtcccgc
tgttcagagatggtgcccggcacagccgactgccacatcactgccgaccgcaaggtgtac
ccacaggcagacacggtcatcgtgcaccactgggatatcatgtccaaccctaagtcacgc
ctcccaccttccccgaggccgcaggggcagcgctggatctggttcaacttggagccaccc
cctaactgccagcacctggaagccctggacagatacttcaatctcaccatgtcctaccgc
agcgactccgacatcttcacgccctacggctggctggagccgtggtccggccagcctgcc
cacccaccgctcaacctctcggccaagaccgagctggtggcctgggcggtgtccaactgg
aagccggactcagccagggtgcgctactaccagagcctgcaggctcatctcaaggtggac
gtgtacggacgctcccacaagcccctgcccaaggggaccatgatggagacgctgtcccgg
tacaagttctacctggccttcgagaactccttgcaccccgactacatcaccgagaagctg
tggaggaacgccctggaggcctgggccgtgcccgtggtgctgggccccagcagaagcaac
tacgagaggttcctgccacccgacgccttcatccacgtggacgacttccagagccccaag
gacctggcccggtacctgcaggagctggacaaggaccacgcccgctacctgagctacttt
cgctggcgggagacgctgcggcctcgctccttcagctgggcactggatttctgcaaggcc
tgctggaaactgcagcaggaatccaggtaccagacggtgcgcagcatagcggcttggttc
acctga

DBGET integrated database retrieval system