KEGG   Homo sapiens (human): 2526Help
Entry
2526              CDS       T01001                                 

Gene name
FUT4, CD15, ELFT, FCT3A, FUC-TIV, FUTIV, LeX, SSEA-1
Definition
fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific) (EC:2.4.1.-)
Orthology
K07632  
galactoside alpha-1,3-fucosyltransferase 4 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Other types of O-glycan biosynthesis
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:hsa00514]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:hsa00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q21
AA seq 530 aa AA seqDB search
MRRLWGAARKPSGAGWEKEWAEAPQEAPGAWSGRLGPGRSGRKGRAVPGWASWPAHLALA
ARPARHLGGAGQGPRPLHSGTAPFHSRASGERQRRLEPQLQHESRCRSSTPADAWRAEAA
LPVRAMGAPWGSPTAAAGGRRGWRRGRGLPWTVCVLAAAGLTCTALITYACWGQLPPLPW
ASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHR
DLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESP
SHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWV
VSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARYKFYLAFENSQHLD
YITEKLWRNALLAGAVPVVLGPDRANYERFVPRGAFIHVDDFPSASSLASYLLFLDRNPA
VYRRYFHWRRSYAVHITSFWDEPWCRVCQAVQRAGDRPKSIRNLASWFER
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcttgtggggcgcggcccggaagccctcgggcgcgggctgggagaaggagtgg
gcggaggcgccgcaggaggctcccggggcctggtcgggccggctgggccccgggcgcagt
ggaagaaagggacgggcggtgcccggttgggcgtcctggccagctcaccttgccctggcg
gctcgccccgcccggcacttgggaggagcagggcagggcccgcggcctttgcattctggg
accgcccccttccattcccgggccagcggcgagcggcagcgacggctggagccgcagcta
cagcatgagagccggtgccgctcctccacgcctgcggacgcgtggcgagcggaggcagcg
ctgcctgttcgcgccatgggggcaccgtggggctcgccgacggcggcggcgggcgggcgg
cgcgggtggcgccgaggccgggggctgccatggaccgtctgtgtgctggcggccgccggc
ttgacgtgtacggcgctgatcacctacgcttgctgggggcagctgccgccgctgccctgg
gcgtcgccaaccccgtcgcgaccggtgggcgtgctgctgtggtgggagcccttcgggggg
cgcgatagcgccccgaggccgccccctgactgccggctgcgcttcaacatcagcggctgc
cgcctgctcaccgaccgcgcgtcctacggagaggctcaggccgtgcttttccaccaccgc
gacctcgtgaaggggccccccgactggcccccgccctggggcatccaggcgcacactgcc
gaggaggtggatctgcgcgtgttggactacgaggaggcagcggcggcggcagaagccctg
gcgacctccagccccaggcccccgggccagcgctgggtttggatgaacttcgagtcgccc
tcgcactccccggggctgcgaagcctggcaagtaacctcttcaactggacgctctcctac
cgggcggactcggacgtctttgtgccttatggctacctctaccccagaagccaccccggc
gacccgccctcaggcctggccccgccactgtccaggaaacaggggctggtggcatgggtg
gtgagccactgggacgagcgccaggcccgggtccgctactaccaccaactgagccaacat
gtgaccgtggacgtgttcggccggggcgggccggggcagccggtgcccgaaattgggctc
ctgcacacagtggcccgctacaagttctacctggctttcgagaactcgcagcacctggat
tatatcaccgagaagctctggcgcaacgcgttgctcgctggggcggtgccggtggtgctg
ggcccagaccgtgccaactacgagcgctttgtgccccgcggcgccttcatccacgtggac
gacttcccaagtgcctcctccctggcctcgtacctgcttttcctcgaccgcaaccccgcg
gtctatcgccgctacttccactggcgccggagctacgctgtccacatcacctccttctgg
gacgagccttggtgccgggtgtgccaggctgtacagagggctggggaccggcccaagagc
atacggaacttggccagctggttcgagcggtga

DBGET integrated database retrieval system